Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR253 IGR252 IGR256 IGR251 IGR255 IGR250 IGR254 CT312 CT303 atpE, - CT310 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 valS, - CT302 CT311 CT312 CT303 atpE, - CT310 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 valS, - CT302 CT311 CT312 atpE, - CT310 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 valS, - CT302 atpK, - CT304 atpD, - CT306 CT309 atpD, - CT306 CT309 CT303 atpK, - CT304 CT311
* Calculated from Protein Sequence

Gene ID: CT307

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpB  

Definition:
ATP synthase beta chain

Gene Start:
344784

Gene Stop:
343471

Gene Length:
1314

Molecular Weight*:
48674

pI*:
5.82

Net Charge*:
-4.85

EC:
3.6.1.34  

Functional Class:
energy metabolism; ATP-proton motive force  

Pathway: pathway table
Energy Metabolism; Oxidative phosphorylation

Comment:
The V-type ATPase complex is a multisubunit complex that
pumps H+ s, typically in intracellular acidic vacuoles.
Several 3D structures are available for this protein.
See CT669, CT717, CT304, CT305, CT306,
CT308, CT309, and CT310.
The CT307 sequence may be internally frameshifted.

From Prosite PDOC00137:

ATP synthase (proton-translocating ATPase) (EC 3.6.1.34) is a component of the cytoplasmic membrane of eubacteria, the inner membrane of mitochondria, and the thylakoid membrane of chloroplasts. The ATPase complex is composed of an oligomeric transmembrane sector, called CF(0), and a catalytic core, called coupling factor CF(1). The former acts as a proton channel; the latter is composed of five subunits, alpha, beta, gamma, delta and epsilon. The sequences of subunits alpha and beta are related and both contain a nucleotide-binding site for ATP and ADP. The beta chain has catalytic activity, while the alpha chain is a regulatory subunit.

Vacuolar ATPases (V-ATPases) are responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Like F-ATPases, they are oligomeric complexes of a transmembrane and a catalytic sector. The sequence of the largest subunit of the catalytic sector (70 Kd) is related to that of F-ATPase beta subunit, while a 60 Kd subunit, from the same sector, is related to the F-ATPases alpha subunit.


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to vacuolar ATPase subunit B
sequences, e.g., residues 5-435 are 33% similar to VAT2_HUMAN.
Hits with highest E-values tended to involve eukaryotic
sequences. Residues 4-433 are 39% similar to ATPB_METJA. CT307 is
similar to TP0427, TP0528, TP0402, TP0529, TP0426 of T.pallidum.
It is similar to MG399 and MG401 of M.genitalium and PG1576 of P.gingivalis.

CT307 is orthologously related to CPn0089:
residues 1-438 are 88% similar to residues 1-432 of CPn0089.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1156
COG name: Vacuolar ATPase/archaeal ATP synthase B subunit (NtpB)
Functional Class:  C
The phylogenetic pattern of COG1156 is amtky-----------oLin-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 71-96, 252-272, 237-281, 304-341 have matches
to blocks BL00152A,C,D, which encompass ATP synthase alpha and beta
chain sequences.

ProDom Summary:  Protein Domain Search
Residues 200-368 are 45% similar to VATB_SCHPO, an ATPase subunit B
chain sequence. Residues 129-164 also correspond to an
ATP synthase domain seen in ATPB_HALVO. (Both reference
sequences are mitochondrial.)

Paralogs:  Local Blast Search
CT307 is paralogously related to CT669 and CT717, both thought to
be F-type ATPases, and partially to CT308, the alpha subunit sequence
of V-type ATP synthase. Residues 1-378 are approximately 25% similar to
CT669 and CT717 and residues 235-309 are 32% similar to CT308.

Pfam Summary:  Pfam Search
Residues 8 to 72 (E-value = 2.6e-14) place CT307 in the ATP-synt_ab_N family which is described as ATP synthase alpha/beta family, beta-barrel domain (PF02874)
Residues 167 to 337 (E-value = 2e-40) place CT307 in the ATP-synt_ab family which is described as ATP synthase alpha/beta family, nucleotide-binding domain (PF00006)

PDB Hit:
gi|2981977|pdb|1SKY|E Chain E, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Atp Synthase, F1fo Atp Synthase, F1-Atpase, Alpha3beta3 Subcomplex Of F1-Atpase, Hydrolase Mol_id: 1; Molecule:

Gene Protein Sequence:
MQTIYTKITDIKGNLITVEAEGASLGELVQIERADGRSSYASVLRFDARK
VTLQVFGGTSGLSTGDKVIFLGRPMEVIYGDSLLGRRFNGTGKPIDREDE
CFGEPIPITTPSFNPVCRIVPREMVRTNIPMIDMFNCLVKSQKIPIFSSS
GENHNALLMRIAAQTDADIVIIGGMGLTFVDYNFFVKESQRLGFADKCVM
FIHKAVDAPVECVLIPDMALACAERFALEQKKNVLVLLTDMTAFADALKE
MAITMDQIPANRGYPGSLYSDLAVRYEKAVDIAQGGSITLISVTTMPGDD
ITHPVPDNTGFITEGQFYLKDNRIDPFGSLSRLKQLVIGKKTREDHGDLA
NALIRLYADSRKSAERMSMGFKLSNWDKKLLAFSELFEARLMSLEVNIPL
EEALDIGWKILSQSFHSEEVGIKEQLIQKYWPKACLHK

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAACGATATATACAAAAATTACGGATATCAAGGGGAACTTGATTAC
TGTGGAGGCAGAAGGCGCCTCTTTAGGTGAATTAGTGCAGATTGAAAGAG
CTGATGGGCGCTCATCGTATGCTTCTGTTTTGCGTTTCGATGCGAGAAAA
GTGACTCTTCAAGTGTTCGGTGGTACTTCTGGATTGTCTACCGGAGACAA
AGTGATTTTCTTAGGAAGACCCATGGAAGTCATTTATGGAGACTCTTTGT
TAGGTCGACGTTTTAATGGAACAGGAAAACCTATTGATCGTGAAGATGAG
TGTTTTGGTGAGCCTATACCTATTACGACACCTTCATTTAATCCTGTTTG
TCGCATTGTGCCTCGGGAGATGGTACGAACGAACATACCGATGATTGATA
TGTTCAACTGCTTGGTCAAATCTCAAAAAATTCCCATTTTCTCTTCTTCT
GGAGAAAATCATAATGCGCTGTTGATGCGTATTGCCGCTCAAACAGATGC
AGATATCGTAATTATTGGAGGGATGGGATTAACGTTTGTTGATTACAATT
TCTTCGTTAAGGAATCTCAGCGGTTAGGTTTCGCCGATAAATGTGTTATG
TTCATTCATAAAGCCGTAGATGCTCCGGTTGAATGTGTATTGATACCAGA
TATGGCTTTAGCTTGTGCAGAGCGTTTTGCTTTAGAACAAAAGAAAAATG
TTCTGGTTCTGCTCACTGATATGACAGCTTTTGCTGATGCATTGAAAGAG
ATGGCTATTACAATGGACCAGATTCCAGCAAATAGGGGATATCCAGGGTC
TTTATATTCCGATCTCGCTGTTCGTTATGAAAAAGCTGTAGACATTGCTC
AAGGCGGATCAATTACTCTGATCAGTGTGACTACGATGCCTGGGGATGAT
ATCACACATCCAGTTCCTGACAATACAGGTTTTATTACAGAAGGACAGTT
CTACTTGAAAGACAATCGAATAGATCCTTTTGGCTCGTTATCTCGACTGA
AGCAGTTGGTTATTGGTAAGAAGACTCGAGAGGATCATGGTGACTTAGCA
AATGCTTTGATTCGTCTTTACGCTGATTCTAGAAAGTCTGCAGAGCGGAT
GTCTATGGGTTTCAAACTCTCTAATTGGGATAAAAAGTTATTAGCGTTTT
CTGAATTATTTGAGGCTCGCTTAATGAGTTTAGAAGTGAATATTCCTCTT
GAAGAAGCTTTGGATATAGGATGGAAAATTTTATCTCAAAGTTTTCATTC
TGAAGAAGTCGGAATTAAAGAGCAGTTAATTCAGAAATATTGGCCTAAAG
CATGTCTTCACAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy