Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR253 IGR252 IGR251 IGR255 IGR250 IGR254 CT303 atpE, - CT310 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 valS, - CT302 CT303 atpE, - CT310 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 valS, - CT302 atpE, - CT310 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 valS, - CT302 atpK, - CT304 atpD, - CT306 CT309 atpD, - CT306 CT309 CT303 atpK, - CT304
* Calculated from Protein Sequence

Gene ID: CT306

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpD  

Definition:
probable ATP synthase subunit D

Gene Start:
343483

Gene Stop:
342875

Gene Length:
609

Molecular Weight*:
23195

pI*:
9.75

Net Charge*:
4.20

EC:
3.6.1.34  

Functional Class:
energy metabolism; ATP-proton motive force  

Pathway: pathway table

Comment:
See CT304, CT305, CT307, CT308, CT309, CT310.

Blast Summary:  PSI-Blast Search
Match in gapped BLAST to a V-type ATPase D subunit of
B. burgdorferi (AE001122): residues 3-198 are 30% similar to this
protein. Residues 5-198 are 33% similar to TP0428, a predicted D subunit
sequence. CT306 is also similar to TP0527. No similarity to M.genitalium.

CT306 is orthologously related to CPn0090:
residues 1-202 are 66% similar to that of CPn0090.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1394
COG name: Archaeal/vacuolar type H+-ATPase subunit D
Functional Class:  C
The phylogenetic pattern of COG1394 is amtky-----------oLin-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
Residues 3 to 200 (E-value = 7.2e-79) place CT306 in the ATP-synt_D family which is described as ATP synthase subunit D (PF01813)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
33  
60
coil-coil  
137  
164

PDB Hit:
none

Gene Protein Sequence:
MSSQIKLTKNSYRAEKQKLNMLGMYLPTLKLKKALLQAEVQSAIRLAAES
TVTNEQARDRMYAFAELFSIPLYTDAVEQCFSVDILEKDVENIAGVEVPL
LKRVVLTSPEYSLLDTPIWLDSLLASVKEYVVSKIYAENAQERLLLLEEE
LRRVSIRVNLFEKKLIPTTSQTLKKIAIFLSDRSITDVGQMKMAKKKIQQ
HKE

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTCACAAATAAAGTTAACGAAAAATTCATATAGAGCTGAGAAACA
AAAGCTTAATATGTTGGGCATGTACTTGCCCACATTAAAATTAAAGAAAG
CTTTGTTACAGGCCGAGGTTCAATCTGCAATCCGTTTAGCTGCAGAAAGT
ACAGTGACTAATGAACAAGCTCGAGATAGAATGTACGCCTTTGCCGAGCT
TTTCAGTATTCCTCTCTATACGGATGCAGTAGAGCAGTGTTTTTCTGTCG
ATATCCTTGAAAAGGATGTCGAGAATATCGCAGGCGTTGAAGTCCCCTTA
CTAAAGCGGGTTGTACTTACTTCTCCAGAGTATTCGTTATTGGATACACC
TATTTGGTTAGACTCTCTTCTTGCATCTGTAAAAGAATATGTTGTGAGTA
AGATTTATGCTGAGAATGCTCAAGAACGACTGCTGCTTTTAGAAGAAGAA
CTTCGGAGAGTCTCTATTCGAGTAAACCTTTTCGAGAAAAAACTCATACC
TACAACTTCGCAAACTCTTAAAAAGATAGCCATTTTCTTAAGTGATAGAA
GTATTACTGATGTGGGACAAATGAAAATGGCTAAGAAAAAAATTCAGCAG
CATAAGGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy