Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR253 IGR252 IGR249 IGR251 IGR250 CT303 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 pknD, - CT301 valS, - CT302 CT303 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 pknD, - CT301 valS, - CT302 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 pknD, - CT301 valS, - CT302 atpK, - CT304 atpD, - CT306 CT309 atpD, - CT306 CT309 CT303 atpK, - CT304
* Calculated from Protein Sequence

Gene ID: CT305

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpI  ntpI  

Definition:
probable vacuolar ATPase subunit I

Gene Start:
342866

Gene Stop:
340920

Gene Length:
1947

Molecular Weight*:
73206

pI*:
6.58

Net Charge*:
-3.33

EC:
3.6.1.34  

Functional Class:
energy metabolism; ATP-proton motive force  

Pathway: pathway table
Energy Metabolism; Oxidative phosphorylation

Comment:
See CT304, CT306, CT307, CT308, CT309, and
CT310. I subunits are typically associated with Na+-translocating
ATP synthases.

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to vacuolar ATPase I subunit sequences,
e.g., residues 9-641 are 20% similar to the B. burgdorferi
enzyme. CT305 is similar to TP0429 of T.pallidum. No similarity to
M.genitalium. Also similar to PG1578 of P.gingivalis.

CT305 is orthologously related to CPn0091:
residues 1-645 are 59% similar to that of CPn0091.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1269
COG name: Archaeal/vacuolar-type H+-ATPase subunit I
Functional Class:  C
The phylogenetic pattern of COG1269 is amtkY-----------oLin-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 458-639 are 20% similar to an ATP synthase subunit I domain
seen in ATPI_METJA. Residues 275-337 and 353-382 also
correspond to domains of this function, e.g., NTPI_ENTHR.


Paralogs:  Local Blast Search
No paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 19 to 641 (E-value = 6.4e-11) place CT305 in the V_ATPase_I family which is described as V-type ATPase 116kDa subunit family (PF01496)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
72
coil-coil  
74  
101
non-globular  
180  
245
transmembrane  
311  
340
transmembrane  
360  
378
transmembrane  
488  
512
transmembrane  
519  
538
transmembrane  
590  
615

PDB Hit:
none

Gene Protein Sequence:
MRVDVDKYLFIGREKSEFFSACREIGAVEFLSKSKLKDSEKVRKLSEGLK
VLNLLTKSCSPADLVSTKSGYLVTEQLLQEIFDLNQEITTLTESLKALGK
EIVRVKPLGDFSSEEIRELTLKTGLAVRFLYKRHIEGAPLEVEEENVFYL
ATAYNYDYYAVIGIVSLSKDIFTEIEAPRSVNELREEEGHLQALLRKKKA
RVCELYAYREDLLEALCEQCNEQSLQHAEVSAEDLFDDKVFSALGWVIVD
RLDEVKKLCDSLGIYLERVQPDPDEVIPTYLENHGLGALGESLVNIYDTP
ASTDKDPSLWVFFSFFVFFSMIINDAGYGLVFLATSLFLSFKARKQIKRS
IALKRFLQMFMILGLGCVCWGGATTSFFGVSVSYTSPFREYSLTHFLALK
KAEYYLKERPKGYKELVHDYPILKEKKTPKEFLLAQSTSSGDSVYKAVVY
DKFIDNILMEIALLVGVVHLSLGMLRYCRQRYSSIGWVIFMCGAYMYLPI
YLQAVSLIHYALHIPYELGGLVGYYVAFIGLGVAILGGVIQRGLRGLDEI
TAVIQVFSDVLSYLRLYALSLAGAMVGNTVMVMSERFSPAVGILIIIFGH
TVNIALSIMGGVIHGLRLNFIEWYHYSFDGGGKLLHPLKKVICQKSQNL

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGCGTAGATGTGGATAAATATCTATTTATTGGACGTGAGAAGTCTGA
ATTTTTCTCTGCATGTCGAGAGATTGGGGCTGTCGAATTTTTATCAAAAA
GTAAACTCAAAGATTCAGAAAAAGTACGAAAGCTTTCTGAGGGATTAAAG
GTTTTAAATCTGCTAACTAAGAGCTGTTCCCCAGCAGATTTAGTATCAAC
GAAGTCAGGCTATTTGGTAACAGAGCAGTTGCTTCAAGAGATCTTTGATC
TTAATCAGGAGATTACAACTCTTACAGAGTCTTTAAAAGCTCTAGGTAAA
GAAATAGTTCGAGTTAAGCCTCTTGGAGATTTTTCATCCGAAGAAATCCG
AGAGTTGACGTTAAAAACAGGTTTAGCAGTTCGATTTCTTTATAAGAGAC
ATATAGAAGGAGCTCCTTTAGAAGTCGAAGAAGAGAATGTTTTCTACTTA
GCAACAGCGTACAACTATGATTACTATGCTGTGATTGGGATAGTTTCTCT
GTCTAAGGATATCTTTACTGAGATAGAGGCGCCGCGTTCTGTCAATGAAT
TAAGAGAGGAGGAGGGGCATCTTCAAGCTCTTTTACGTAAAAAGAAGGCT
CGAGTTTGTGAGTTATATGCTTATCGAGAGGATCTTTTAGAGGCTTTATG
TGAACAATGCAATGAACAAAGTTTACAGCATGCAGAAGTTAGTGCAGAAG
ATCTGTTTGATGATAAGGTTTTTAGCGCTTTAGGCTGGGTGATTGTAGAT
CGTTTAGATGAAGTGAAGAAACTTTGTGATAGTTTAGGCATTTATCTAGA
ACGGGTGCAGCCTGATCCAGATGAGGTGATTCCTACATATTTAGAGAATC
ATGGTCTGGGAGCATTAGGGGAGTCTTTGGTTAATATTTATGATACTCCT
GCATCAACGGATAAAGACCCTTCATTATGGGTCTTTTTCTCTTTTTTCGT
TTTTTTCTCGATGATTATTAATGACGCAGGATATGGATTAGTTTTTTTAG
CAACATCGTTATTTTTATCATTTAAAGCTCGGAAACAGATTAAGCGCTCT
ATAGCATTAAAACGCTTTCTGCAGATGTTTATGATATTAGGGCTTGGATG
TGTGTGTTGGGGAGGAGCTACAACATCCTTTTTTGGCGTTTCTGTGAGTT
ACACCAGCCCTTTCCGGGAGTATTCACTAACACATTTTCTGGCTTTGAAG
AAAGCGGAGTATTATCTGAAGGAGCGTCCTAAGGGTTATAAGGAATTGGT
GCATGATTATCCTATTCTTAAAGAGAAGAAAACTCCTAAAGAGTTTCTTC
TAGCCCAAAGTACTAGTAGCGGGGACTCAGTATATAAAGCCGTTGTTTAC
GATAAGTTTATAGATAATATTTTAATGGAAATAGCTTTGCTAGTGGGGGT
AGTACATCTGTCATTGGGAATGCTACGCTATTGTAGACAGCGGTATTCTT
CTATAGGATGGGTAATCTTTATGTGCGGAGCATATATGTATCTGCCTATC
TATTTGCAAGCCGTATCTTTAATTCATTATGCTCTACATATTCCTTATGA
ATTAGGAGGGTTGGTGGGGTATTATGTAGCGTTTATTGGCTTAGGGGTTG
CCATTTTAGGTGGGGTAATCCAAAGGGGATTAAGAGGATTAGATGAGATA
ACAGCTGTTATCCAAGTGTTTTCAGACGTTTTATCCTATTTGCGGTTGTA
CGCTCTGAGTTTAGCTGGAGCGATGGTTGGGAATACTGTGATGGTTATGA
GTGAAAGATTTTCCCCCGCAGTAGGAATTCTAATTATTATCTTCGGGCAC
ACGGTAAATATTGCGCTTTCCATTATGGGAGGTGTGATCCATGGTTTACG
CCTTAATTTCATAGAGTGGTATCACTATAGCTTCGATGGTGGTGGAAAGC
TTTTGCATCCATTGAAAAAAGTAATTTGTCAAAAGTCGCAAAATCTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy