Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR253 IGR252 IGR249 IGR251 IGR250 CT303 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 pknD, - CT301 valS, - CT302 CT303 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 pknD, - CT301 valS, - CT302 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 pknD, - CT301 valS, - CT302 atpK, - CT304 atpD, - CT306 atpD, - CT306 CT303 atpK, - CT304
* Calculated from Protein Sequence

Gene ID: CT304

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpK  

Definition:
vacuolar ATP synthase K subunit

Gene Start:
340875

Gene Stop:
340432

Gene Length:
444

Molecular Weight*:
15210

pI*:
8.36

Net Charge*:
2.32

EC:
3.6.1.34  

Functional Class:
energy metabolism; ATP-proton motive force  

Pathway: pathway table
Energy Metabolism; Oxidative phosphorylation

Comment:
See CT305, CT306, CT307, CT308, CT309, and CT310.
If this is indeed a K subunit sequence, it could function as a Na+-translocating enzyme.
This domain is not observed in C.pneumoniae, however see BLAST similarity of 75%.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to V-type ATP synthase sequences, e.g.,
residues 1-134 are 23% similar to VATL_NEPNO. Residues 9-135 are
29% similar to the K subunit of B.burgdorferi (AE001122). CT304 is similar to
TP0430 of T.pallidum. No similarity to M.genitalium.

Residues 8-135 are 75% similar to residues 1-128 of C.pneumoniae
(gb|AAD18245|) (Cpn0092).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0636
COG name: FoF1-type ATP synthase c subunit/Vacuolar ATPase/archaeal ATP synthase K subunit
Functional Class:  C
The phylogenetic pattern of COG0636 is AmtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 14-73 are 33% similar to a proteolipid ATPase domain in
ATPL_SULAC.

Paralogs:  Local Blast Search
No paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
16  
37
transmembrane  
85  
106
transmembrane  
112  
146

PDB Hit:
none

Gene Protein Sequence:
MSSERKYMIDVSVVGPVLAMALAMIGSAVGCGMAGVASHAVMSRIDEGHG
KIIGLSAMPSSQSIYGLIFMLLLNDAIKDGKVSAVSGIVMGIAVGSALLL
SAFMQGKCCVSAIQAYARSSAIYGKSFASIGIVESFALFAFVFALLLF

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTAGTGAGAGGAAATATATGATAGATGTATCAGTAGTGGGGCCTGT
ATTGGCTATGGCTTTGGCAATGATTGGTAGCGCTGTTGGATGTGGAATGG
CTGGAGTCGCTTCTCACGCAGTGATGTCTCGAATCGATGAAGGACACGGG
AAGATTATTGGTCTGTCTGCTATGCCCTCATCACAATCCATTTACGGGTT
GATTTTCATGTTACTGCTGAATGATGCAATTAAGGATGGAAAAGTCTCTG
CAGTCAGTGGTATCGTAATGGGTATAGCTGTAGGATCTGCGTTATTGCTT
TCTGCTTTTATGCAAGGGAAGTGCTGTGTGAGTGCTATTCAAGCCTATGC
GCGTTCCTCTGCAATATATGGTAAATCATTTGCTTCGATTGGGATTGTTG
AGTCTTTTGCGTTATTTGCTTTCGTTTTTGCGCTATTGTTATTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy