Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR253 IGR252 IGR249 IGR251 IGR250 CT303 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 pknD, - CT301 valS, - CT302 CT303 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 pknD, - CT301 valS, - CT302 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 pknD, - CT301 valS, - CT302 atpK, - CT304 atpD, - CT306 atpD, - CT306 CT303 atpK, - CT304
* Calculated from Protein Sequence

Gene ID: CT303

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
340508

Gene Stop:
339996

Gene Length:
513

Molecular Weight*:
19407

pI*:
7.86

Net Charge*:
2.24

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CT303 is orthologously related to CPn0093: residues 7-164 of CT303 are 55% similar to residues 3-166 of CPn0093, a predicted Chlamydia-specific hypothetical protein from C. pneumoniae. No similarities to T. pallidum or M. genitalium.



COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
50

PDB Hit:
None.

Gene Protein Sequence:
MVNHLLRLGLLSLLRYLLSFLRYCYSKWWAAAFSALCLGGCSQPALSSFL
EFIDNDYTAAAHLGIDRGCVTESVGQQLVVTWGLPSRFRDSLPVVLHVWV
YYGNGEAAKFSYDVQHLSGYQVYTLKENDYQDRQGIISYKVSLTKDGKEI
LSRSHHLWMEVISLKAFSQLS

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTAAATCATTTGCTTCGATTGGGATTGTTGAGTCTTTTGCGTTATTT
GCTTTCGTTTTTGCGCTATTGTTATTCTAAGTGGTGGGCAGCGGCGTTCT
CTGCTCTGTGTTTAGGAGGATGCTCGCAGCCTGCATTATCTTCGTTTTTA
GAGTTTATAGATAATGACTATACAGCTGCAGCTCATCTAGGTATAGATCG
GGGATGTGTTACGGAGTCTGTAGGGCAGCAGCTAGTTGTCACTTGGGGGC
TGCCTTCACGTTTTAGAGATTCTCTCCCTGTGGTTCTTCACGTATGGGTA
TATTACGGTAATGGAGAGGCTGCCAAATTTTCTTATGATGTGCAACATCT
TTCAGGCTATCAGGTATATACCCTCAAAGAGAACGATTACCAAGATCGGC
AAGGTATCATTTCTTATAAAGTTTCTTTGACAAAAGATGGTAAAGAAATT
TTAAGTCGGAGCCATCACTTATGGATGGAAGTAATTTCATTAAAAGCTTT
TAGTCAGTTGTCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy