Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR249 IGR248 IGR246 IGR250 IGR247 CT303 pknD, - CT301 valS, - CT302 CT300 radA,sms, - CT298 CT303 pknD, - CT301 valS, - CT302 CT300 radA,sms, - CT298 pknD, - CT301 valS, - CT302 atpK, - CT304 CT303 atpK, - CT304 CT300 radA,sms, - CT298 rnc, - CT297 hemC, - CT299 rnc, - CT297 hemC, - CT299
* Calculated from Protein Sequence

Gene ID: CT301

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pknD  

Definition:
probable serine/threonine kinase

Gene Start:
337032

Gene Stop:
334231

Gene Length:
2802

Molecular Weight*:
107645

pI*:
6.64

Net Charge*:
-3.98

EC:
2.7.1.-  

Functional Class:
translation; protein modification  

Pathway: pathway table
Metabolism of Complex Carbohydrates; Starch and sucrose metabolism

Comment:
CT301 could be a checkpoint kinase (EC 2.7.1.-). This
gene tentatively designated pknD. See CT145 and CT673.

CT301 was not assigned an EC number during our original annotation. Comparison
of our annotation with the annotation done by KEGGs leads us to re-examine this protein.

The top hits in Gapped-BLAST were to putative serine/threonine-protein kinases which are assigned the EC number 2.7.1.- in the Swiss-Prot database.

The putative serine/threonine-protein kinases which shows similiarity to CT301 are given the EC number 2.7.1.-.
The region of similiarity between CT301 and kinases is confined to the 268 N-terminal amino acids of both the query and the resulting database hits (of a total of 934 amino acids for CT301 and a total of around about 620 amino acids of the putative serine/threonine-protein kinases).

Additional searching of the PDB database with Psi-blast and searching of the PFAM database supports the existance of a kinase domain. The EC number for CT301 has been changed to 2.7.1.-.


Blast Summary:  PSI-Blast Search
Partial hits in gapped BLAST to serine/threonine kinase sequences, e.g.,
residues 2-351 are 23% similar to the mouse microtubule-associated
serine/threonine protein kinase (A54602). Most hits are to eukaryotic
sequences (see ProDom summary). Residues 10-236 are 29% similar to AC002376,
thought to be a protein kinase, and residues 18-288 are 22% similar to
AF026207, also thought to be a protein kinase. CT301 is similar to MG109,
a predicted protein serine/threonine kinase in M.genitalium: residues
30-292 are 23% similar to this protein. No similarity to T.pallidum.

CT301 is orthologously related to CPn0095: residues 15-917 of CT301 are 47% similar to residues 1-902 of CPn0095, a predicted S/T protein kinase from C. pneumoniae.
CT301 is also similar to CPn0703, a predicted S/T protein kinase from C. pneumoniae: residues 49-299 are 28% similar to residues 63-261 of CPn0703.



COGS Summary:  COGS Search
BeTs to 7 clades of COG0515
COG name: Serine/threonine protein kinases
Functional Class:  T
The phylogenetic pattern of COG0515 is amtkYq-C-BR---gp-lIN-
Number of proteins in this genome belonging to this COG is 3


Blocks Summary:  Blocks Search
Residues 128-158 and 216-231 have matches to blocks BL00107A,B, which
encompass ATP-binding protein kinases. See CHK1_SCHPO and CDS1_SCHPO.

ProDom Summary:  Protein Domain Search
Residues 33-158 are 25% similar to a domain found in serine/threonine kinases,
e.g., in PKD1_DICDI. Residues 105-218, 126-160, 197-230, 198-249, and
837-849 also correspond to domains and support the assignment, as evidenced
by similarities to KC1G_BOVIN, RH_RAT, M38B_HUMAN, ERK5_HUMAN.

Paralogs:  Local Blast Search
CT301 appears to be paralogously related to CT673 and CT145: residues 5-299 are 25% similar to
CT673, thought to be a serine/threonine kinase, and residues 4-236 are 20%
similar to CT145, a possible kinase of the S/T type

Pfam Summary:  Pfam Search
Residues 4 to 292 (E-value = 9e-46) place CT301 in the Pkinase family which is described as Protein kinase domain (PF00069)

PDB Hit:
gi|3114436|pdb|1A06| Calmodulin-Dependent Protein Kinase From Rat Kinase, Signal Transduction, CalciumCALMODULIN Mol_id: 1; Molecule: CalciumCALMODULIN-Dependent Protein Kinase; Chain: Null; Ec: 2.7.1.123; Engineered: Yes

Gene Protein Sequence:
MQRYELIRLIGKGGMGEVYLAHDKACSRRVALKRIREDLSGNALLRQRFL
REAKIAADLIHPGIVPVYSICSDGEAVYYTMPYIEGFSLKSLLKSVWQKE
VLSKELEEKTSVKSFLPIFDKICATVEYIHSKGVLHRDLKPDNILLGLFG
EVVIIDWGAAIFKHAKELKLEQDDEAAVSFDERNICYSSMTIPGKIVGTP
DYMAPESLLGVEASEKTDIYALGLILYQMLTLAFPYRRKKGRKLSYRDVV
LPPIEMSPYREIPPSLSQIAMKAIAINPADRFSSIQELRQALQPYLQGDP
EWTVKATLMAKEKSCWKYYDPILLSRYFPVLASSPAQWYNFMLSEVEISA
STRVEYTVTKSAVHEGMGILFLPSKEAERGEFYCGYGLWFSVQNHELTVS
LIKNGIEIQKKSQEMISQQSRFAILIEKSDNRIAVFVEQALFILHIDYLP
SLGNRLGVIIQDLQGMSNIAISESIGALRVSCLAVPDAFLSEKLYDQAAI
FYRKIRDSFPGRKESYEAQFRLGVTLLTQIEEQGGDLTQALSSFDYLHGG
AGAPLEYLGKALVYQRNGSFVEEIRCLLFALKRYSQHPEIPRLEDHLCFR
LYDSLHKHRSEALVFMLLILWIAPEKISVREEERFLRIIYHKQQATLFCQ
VDKAPLQFRSSKMELFLSFWTGFSLFLPELFRRAGGLRDYQALADIFYVA
GVSGNREAFMQFSTALANVSDEITFPESLHNQKVAELMFFVKGVEALRNK
DYQKAKKLLWKTPFTLQLYALDMFHIQAFLDEEIESFIDLLQAIYDPASE
EERDHILVYIIQTHLWNRDLERAYKLLNDRFPLDEELAEYSEAFILWGCY
LALTGDRVVVKAHFSRCRYKYGKSALIGKCVDGDIFDYLDNLVWWEKKMT
LFQSYFLLRCLNESPRRYEKYRQAYLSMENNFFD

Gene Nucleotide Sequence:  Sequence Viewer
TTGCAACGATACGAATTGATTAGGCTGATAGGCAAAGGAGGCATGGGCGA
AGTCTATTTAGCCCATGACAAAGCGTGTTCTCGTCGAGTGGCTCTGAAGA
GGATCCGAGAGGATCTGAGTGGGAATGCGCTGCTTAGACAACGCTTTTTG
CGAGAGGCAAAAATTGCTGCAGACCTCATACATCCAGGTATTGTTCCTGT
ATATTCGATATGCAGCGATGGTGAGGCTGTATATTACACAATGCCTTATA
TAGAAGGGTTTTCTCTAAAAAGTTTATTAAAGAGTGTTTGGCAGAAAGAA
GTTCTTTCTAAAGAACTAGAAGAAAAAACCTCTGTTAAATCTTTTCTTCC
TATTTTTGATAAAATTTGTGCCACGGTGGAATACATTCATTCTAAAGGAG
TGTTGCATCGGGATTTAAAGCCGGATAATATCTTACTGGGTTTGTTTGGG
GAAGTTGTTATCATTGATTGGGGAGCAGCTATCTTTAAACATGCCAAAGA
GTTAAAGCTAGAACAGGATGATGAAGCTGCTGTTTCATTCGACGAGAGAA
ATATCTGCTATTCCAGCATGACCATTCCAGGCAAGATTGTAGGGACTCCA
GATTATATGGCTCCCGAAAGCTTGTTGGGAGTAGAAGCATCGGAAAAAAC
GGACATATATGCACTAGGGCTCATTCTTTATCAAATGTTGACTTTAGCTT
TCCCTTATCGAAGAAAAAAAGGTCGTAAGCTGTCTTATAGAGATGTTGTT
TTGCCTCCTATCGAAATGTCACCCTATAGGGAAATCCCGCCTTCTTTATC
TCAAATTGCTATGAAAGCAATCGCCATTAATCCTGCGGATAGGTTTTCTT
CTATTCAGGAGTTACGCCAAGCTTTGCAGCCATATCTTCAGGGTGATCCA
GAGTGGACAGTAAAAGCTACTTTGATGGCTAAGGAGAAATCGTGTTGGAA
ATATTATGACCCTATCCTACTCTCACGCTATTTCCCTGTACTAGCAAGTT
CCCCTGCTCAATGGTATAATTTTATGCTCTCCGAGGTGGAAATAAGTGCT
TCTACGCGTGTGGAGTATACCGTTACAAAAAGTGCAGTTCATGAAGGGAT
GGGGATTCTTTTCCTACCTTCTAAGGAGGCTGAAAGAGGAGAGTTTTACT
GTGGTTACGGACTATGGTTTTCTGTCCAGAATCATGAACTTACGGTCTCT
CTTATCAAAAATGGAATAGAGATTCAGAAAAAATCCCAAGAGATGATTTC
TCAGCAATCTCGTTTTGCTATTTTGATAGAAAAATCAGACAACAGAATCG
CAGTCTTTGTTGAGCAAGCTTTATTTATTTTACATATAGACTACCTTCCT
AGCTTAGGTAATCGTCTAGGCGTCATTATTCAAGATTTACAAGGAATGAG
CAATATTGCGATTTCGGAAAGTATAGGAGCTTTGCGAGTCAGCTGTTTAG
CTGTTCCTGACGCGTTCTTATCTGAAAAGCTGTATGATCAAGCTGCAATC
TTTTATCGTAAAATTCGAGATTCTTTTCCGGGTAGAAAAGAAAGTTATGA
AGCGCAGTTTCGTCTGGGAGTGACCTTATTAACTCAAATTGAGGAGCAGG
GCGGAGATCTGACGCAAGCTCTTAGTTCTTTTGATTATCTTCATGGAGGT
GCTGGCGCCCCATTGGAATATCTTGGCAAAGCGTTAGTTTACCAGAGGAA
CGGAAGTTTTGTAGAAGAGATACGATGTTTGTTGTTTGCTTTAAAAAGAT
ATTCACAGCACCCCGAGATTCCGCGATTAGAAGATCATCTTTGCTTCCGC
TTGTATGATAGTTTACACAAGCATCGCAGCGAAGCGCTAGTATTCATGTT
GTTAATTTTGTGGATCGCTCCAGAAAAGATTAGTGTTAGAGAGGAGGAGC
GTTTCCTTAGGATTATTTATCATAAGCAACAAGCTACCTTGTTCTGTCAG
GTAGATAAGGCTCCTTTGCAGTTTAGATCTTCTAAGATGGAGCTTTTCCT
TAGTTTTTGGACAGGATTTTCCTTATTCCTTCCCGAACTATTTCGTAGAG
CAGGGGGATTGCGGGATTATCAAGCGCTTGCAGATATTTTTTATGTTGCA
GGAGTTTCAGGGAACAGGGAAGCATTTATGCAATTCTCTACAGCTTTAGC
GAACGTATCCGATGAAATCACATTCCCTGAGTCTTTACACAATCAAAAGG
TAGCGGAATTAATGTTCTTTGTTAAGGGGGTGGAGGCTTTGCGGAACAAG
GATTATCAAAAAGCTAAGAAGCTTTTGTGGAAGACTCCATTTACTTTGCA
GTTGTATGCTTTGGATATGTTCCACATACAGGCTTTTTTGGATGAAGAGA
TCGAGTCTTTCATAGATCTTTTACAAGCTATCTATGACCCAGCCAGTGAA
GAGGAGCGCGATCATATTCTCGTTTATATAATACAGACCCATTTATGGAA
TAGAGATCTAGAGCGAGCTTATAAGCTATTAAATGATAGATTCCCTCTAG
ACGAAGAGCTGGCAGAGTATTCGGAAGCATTTATTCTTTGGGGATGCTAC
TTAGCTTTGACTGGGGATCGTGTTGTTGTTAAAGCGCATTTTTCTCGTTG
CCGGTATAAATACGGTAAGTCAGCTTTAATCGGAAAATGTGTGGACGGTG
ATATATTTGATTATTTAGATAATCTTGTCTGGTGGGAGAAGAAAATGACG
CTGTTTCAAAGTTACTTTCTTCTTCGTTGTTTAAATGAGTCTCCAAGACG
ATACGAAAAATATCGACAAGCTTATCTTTCTATGGAGAACAATTTTTTTG
AT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy