Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR249 IGR248 IGR243 IGR246 IGR244 IGR245 IGR247 dcrA, - CT296 sodA,sodM, - CT294 accD, - CT293 mrsA,mrsA, - CT295 pknD, - CT301 CT300 radA,sms, - CT298 dcrA, - CT296 sodA,sodM, - CT294 accD, - CT293 mrsA,mrsA, - CT295 pknD, - CT301 CT300 radA,sms, - CT298 dcrA, - CT296 sodA,sodM, - CT294 accD, - CT293 mrsA,mrsA, - CT295 pknD, - CT301 CT300 radA,sms, - CT298 rnc, - CT297 hemC, - CT299 rnc, - CT297 hemC, - CT299
* Calculated from Protein Sequence

Gene ID: CT298

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
radA  sms  

Definition:
RadA-related DNA repair protein (sms)

Gene Start:
331368

Gene Stop:
332729

Gene Length:
1362

Molecular Weight*:
49772

pI*:
7.57

Net Charge*:
2.44

EC:
 

Functional Class:
DNA replication and repair  

Pathway: pathway table

Comment:
CT298 appears to be a member of the RadA family, which is thought to play a role in endogenous damage
repair. The BACSU and ECOLI enzymes are zinc-finger proteins.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to RADA-related DNA repair proteins, e.g.
residues 4-451 are 48% similar to RADA_BACSU. Residues 1-425 are 37% similar to TP1022, a predicted DNA repair protein in T.pallidum.
CT298 is weakly similar to MG239, an ATP-dependent protease in M.genitalium. Also similar to PG207 of P.gingivalis.

CT298 is orthologously related to CPn0053: residues 1-453 of CT298 are 71% similar to residues 1-452 of CPn0053, a predicted Sms protein from C. pneumoniae.
CT298 is also similar to TP1022, a predicted DNA repair protein RadA (DNA repair protein Sms) from T. pallidum.

COGS Summary:  COGS Search
BeTs to 10 clades of COG1066
COG name: Predicted ATP-dependent serine protease (Sms family)
Functional Class:  O
The phylogenetic pattern of COG1066 is -----Qvcebrhuj---linx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 4-450 are 48% similar to a DNA repair domain as seen in RADA_BACSU.
Residues 80-218 are similar to a domain of RECA_SPIPL and residues 334-450
are similar to a domain of LON2_BACSU.

Paralogs:  Local Blast Search
No paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
125  
194

PDB Hit:
None.

Gene Protein Sequence:
MTTKIKTQWTCTECGTHSPKWLGQCSGCLQWNTLVEERTAPKLNTSSYSS
SSSIPIPLNNVEFQEEIRIHTQAQGWNRLLGGGTVRGSLALLGGEPGIGK
STLLLQISSQFAAAGHKVLYVCGEESVSQTSLRAQRLQISSNNIFLFPET
NLEDIKQQIDNIAPDILVIDSIQIIFSPSLSSAPGSVAQVRETTAELMHI
AKQKQITTFIIGHVTKSGEIAGPRILEHLVDTVLYFEGNAHANYRMIRSV
KNRFGPTNELLILSMHTDGLREVENPSGLFLQEKIVETTGSTIIPIVEGS
ETLLIEVQALVSSSPFSNPVRKTSGFDPNRFSLLLAVLEKRANVKLYTSD
VFLSIAGGLKITQPSADLGAVLSVVSSLYNRYLPKNYTYTGEIGLGGEIR
HVSHMEHRIKESIIMGFKGIVMPFGQIKGLPKEFLDQIDIIGVKTIKDAV
RLLQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAACAAAAATTAAAACACAGTGGACGTGTACAGAATGTGGCACACA
TTCTCCAAAATGGTTGGGACAATGTTCTGGATGTCTCCAGTGGAATACAC
TAGTCGAAGAAAGAACAGCTCCTAAACTAAACACATCTTCTTACTCCTCT
AGCTCTTCTATTCCCATACCACTAAACAATGTGGAATTTCAGGAAGAAAT
ACGAATTCATACCCAAGCTCAAGGCTGGAATCGCCTTCTAGGAGGAGGAA
CGGTCCGAGGTAGCCTCGCTCTATTGGGAGGAGAGCCTGGCATAGGAAAG
TCTACTTTACTACTTCAAATTTCCTCACAATTCGCGGCAGCTGGTCATAA
AGTGTTGTACGTTTGCGGAGAAGAATCCGTGTCCCAAACTTCATTACGAG
CCCAACGCCTGCAAATCTCTAGCAACAATATTTTCCTATTCCCAGAAACA
AATCTTGAAGACATCAAACAACAGATTGATAACATTGCTCCAGACATATT
AGTTATCGACTCTATCCAGATCATTTTTTCTCCATCCTTAAGCTCTGCTC
CAGGATCGGTTGCTCAAGTGAGAGAAACGACCGCAGAGCTCATGCATATA
GCAAAACAAAAACAGATCACAACCTTTATTATTGGACATGTCACTAAATC
TGGAGAAATCGCTGGCCCACGTATCCTAGAACACTTAGTAGACACTGTTC
TCTATTTTGAAGGTAATGCGCATGCTAATTACCGTATGATTCGCTCTGTT
AAGAATCGTTTCGGCCCAACCAATGAATTATTAATTTTATCCATGCATAC
AGATGGATTACGCGAAGTAGAAAATCCGTCAGGTCTCTTTCTACAAGAAA
AAATTGTAGAAACTACAGGCTCTACCATTATCCCTATTGTAGAAGGCTCT
GAAACTCTTCTTATAGAAGTTCAGGCTCTCGTTTCTTCATCCCCATTTTC
TAATCCTGTACGAAAAACATCCGGATTTGATCCAAACCGATTTTCTTTAC
TCTTAGCTGTTTTAGAAAAAAGAGCGAATGTTAAATTATATACATCCGAT
GTCTTCCTTTCTATCGCTGGAGGCTTGAAAATCACACAACCTTCGGCAGA
CTTAGGAGCGGTGTTATCGGTGGTGTCTTCCCTATATAACCGCTATTTAC
CTAAAAATTATACCTATACTGGAGAGATCGGCCTAGGAGGAGAAATTCGT
CACGTTTCACACATGGAACACCGCATAAAAGAAAGCATTATTATGGGGTT
TAAAGGTATCGTGATGCCTTTTGGGCAGATAAAAGGCTTACCTAAAGAAT
TTCTGGATCAAATTGATATTATTGGAGTAAAAACAATTAAAGATGCTGTC
CGCTTACTACAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy