Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR241 IGR240 IGR242 IGR239 IGR243 IGR246 IGR244 IGR245 IGR247 dut, - CT292 dcrA, - CT296 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 accD, - CT293 CT289 mrsA,mrsA, - CT295 CT300 radA,sms, - CT298 dut, - CT292 dcrA, - CT296 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 accD, - CT293 CT289 mrsA,mrsA, - CT295 CT300 radA,sms, - CT298 dut, - CT292 dcrA, - CT296 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 accD, - CT293 CT289 mrsA,mrsA, - CT295 CT300 radA,sms, - CT298 rnc, - CT297 hemC, - CT299 rnc, - CT297 hemC, - CT299
* Calculated from Protein Sequence

Gene ID: CT295

DNA Molecule Name:
1  

Genbank ID:
3328710

Gene Name:
mrsA  mrsA  

Definition:
phosphomannomutase

Gene Start:
329961

Gene Stop:
328183

Gene Length:
1779

Molecular Weight*:
67294

pI*:
4.90

Net Charge*:
-19.32

EC:
5.4.2.8  

Functional Class:
energy metabolism; starch and sucrose metabolism  

Pathway: pathway table
Carbohydrate Metabolism; Fructose and mannose metabolism

Comment:
Phosphomannomutase converts mannose-1-phosphate to mannose-6-phosphate. See CT815.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to phosphomannomutase sequences,
e.g., residues 18-576 are approximately 35% similar to YHXB_BACSU. Residues
40-551 are 34% similar to TP0642 of T.pallidum, a predicted phosphomannomutase.
CT295 is also similar to TP0413 and to MG053 of M.genitalium and similar to PG1754 of P.gingivalis.

CT295 is orthologously related to CPn0056:
residues 1-587 are 56% similar to residues
1-592 of CPn0056.

COGS Summary:  COGS Search
BeTs to 17 clades of COG1109
COG name: Phosphomannomutase
Functional Class:  G
The phylogenetic pattern of COG1109 is aMTKYQVCEBRHUJgpOLINx
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
Matches of residues 56-66, 150-159, 303-314, and 533-550
to blocks BL00710A,B,C,D support the assignment of this
sequence to the phosphoglucomutase/phosphomannomutase
family.

ProDom Summary:  Protein Domain Search
Residues 207-464 are approximately 30% similar to a domain
seen in phosphomannomutase proteins, e.g., CPSG_MYCPI.
Residues 72-190, 99-172, 150-197, and 526-553 support this
assignment; see Y740_HAEIN, MANB_MYCPN, MANB_METJA.

Paralogs:  Local Blast Search
CT295 appears to be paralogously related to CT815, thought to be
a MrsA-like protein, possibly a phosphogluco or phosphomannomutase.

Pfam Summary:  Pfam Search
Residues 52 to 194 (E-value = 7e-61) place CT295 in the PGM_PMM_I family which is described as Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I (PF02878)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
90
non-globular  
549  
593

PDB Hit:
gi|1310948|pdb|3PMG|A Chain A, Phosphoglucomutase Mol_id: 1; Molecule: Alpha-D-Glucose-1,6-Bisphosphate; Chain: A, B; Synonym: Phosphoglucomutase; Ec: 5.4.2.2; Heterogen: Mg

Gene Protein Sequence:
MEIPRRKIEGMFDPQTAKNILSWLEDVVCDHTSVLTLLDNDPERLRELFS
ETLTFGTAGLRGLVGIGTNRLNVFTIRRATQGLARVLKRRYPDEKISVVI
GYDTRHYSFEFGQETAKVLAGNGILAYLFQIPEPLALVSYSVRELQAKAG
VMITASHNPPPYNGYKVYMSTGGQVLPPMDQEIVEEFQKVEMVSAVESLD
HPYIRMVQEDMENCYEETLHNLQLCEEDNRRHGSLLRISYSPLHGTGVTM
IPRILKDWGFSSVSLVEKQIVPDGDFSTVVLPNPEDPEALVLGIQQMVEQ
KDDLFIATDPDSDRIGVVSLEKEGPYRFNGNQIACLLAAHILSKESQKAP
LGAEDKVVKSLVTTELLTAISESYGANIVNVGAGFKYIGEKIELWRSGME
RFIFGAEESYGYLYGSYVEDKDAMIAAALISEAALQQKIRGCTLRDALLE
LYEVYGYYANRTESIDLPIDQPQRKQELLDRWETQDPLRMSLSSRKLIAF
ENYNTGEGRDLVTDITYKLSLPKMSMLCFYYEGDCRVIVRPSGTEPKMKL
YFEIKQSFSEFSKERTVREAREKESFEALQQFIKETKSYLFYS

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAATTCCTAGAAGGAAAATAGAGGGAATGTTTGATCCTCAAACAGC
CAAAAACATTTTGTCTTGGCTTGAGGATGTTGTTTGCGACCACACCTCTG
TTTTAACCCTGCTTGATAATGATCCTGAGCGATTGAGAGAGTTATTTAGT
GAGACGTTAACCTTTGGGACTGCCGGATTACGAGGTCTCGTGGGAATAGG
GACAAATCGCTTAAATGTTTTTACAATTAGGAGAGCAACACAGGGTTTAG
CCCGAGTCTTAAAGCGAAGATATCCAGATGAGAAGATTAGTGTTGTGATT
GGGTATGATACGCGTCATTATTCTTTCGAGTTCGGACAAGAGACTGCTAA
GGTTTTAGCTGGTAACGGTATTCTTGCTTATTTATTTCAGATTCCAGAGC
CTTTGGCGTTAGTTTCTTATTCAGTGCGAGAGCTTCAGGCTAAAGCTGGG
GTCATGATTACCGCTTCGCATAATCCTCCCCCCTACAATGGTTATAAAGT
ATACATGTCAACAGGAGGACAAGTCCTTCCGCCCATGGATCAGGAAATCG
TGGAAGAGTTCCAGAAGGTGGAGATGGTCTCTGCTGTAGAGAGTTTAGAT
CATCCATATATTCGCATGGTTCAAGAGGATATGGAGAATTGCTACGAGGA
AACTCTACATAATTTGCAGTTATGCGAAGAAGATAATCGGCGGCATGGTT
CGCTATTGCGAATCAGTTATTCTCCACTACATGGTACCGGAGTAACTATG
ATTCCGAGGATATTGAAAGATTGGGGTTTCTCTTCAGTATCTTTGGTTGA
AAAACAAATAGTTCCAGATGGGGATTTCTCTACAGTGGTTCTTCCTAATC
CTGAAGATCCTGAAGCCTTGGTATTGGGTATTCAGCAGATGGTAGAGCAA
AAAGATGATTTGTTTATCGCAACAGATCCAGATTCGGACAGGATAGGGGT
GGTTTCTTTAGAGAAAGAAGGTCCTTATAGATTTAACGGTAATCAGATTG
CTTGCTTATTGGCTGCACATATCTTGAGTAAAGAGTCTCAAAAGGCTCCT
TTGGGTGCGGAAGATAAAGTAGTGAAGAGCCTTGTAACAACAGAGCTTTT
AACAGCCATCTCAGAGTCTTATGGAGCCAATATCGTTAATGTTGGTGCAG
GCTTTAAATATATAGGTGAAAAAATAGAATTATGGCGTTCCGGTATGGAG
CGATTTATTTTTGGAGCAGAGGAGTCTTATGGGTATCTGTATGGCTCGTA
TGTAGAAGATAAAGACGCTATGATTGCTGCGGCGCTCATTTCTGAGGCAG
CGTTGCAGCAAAAAATACGAGGGTGTACGTTACGAGATGCTCTGTTAGAG
CTTTATGAGGTCTATGGCTATTATGCTAACCGGACAGAGTCGATAGATCT
TCCTATCGATCAACCTCAGCGGAAACAAGAACTGTTGGATCGTTGGGAAA
CACAGGATCCTCTTCGGATGTCTTTGTCAAGTCGTAAATTAATTGCCTTT
GAAAATTACAATACAGGGGAAGGACGCGATTTAGTTACCGATATTACGTA
CAAATTATCTTTACCCAAGATGTCGATGCTTTGTTTCTATTATGAAGGAG
ATTGTAGAGTAATTGTACGGCCTTCAGGAACTGAGCCGAAAATGAAGCTG
TATTTTGAAATCAAGCAAAGTTTTTCAGAATTTTCTAAAGAGCGAACTGT
CCGTGAAGCTCGAGAAAAGGAGAGTTTTGAAGCTTTGCAACAATTCATTA
AAGAAACCAAGAGTTACCTTTTTTACTCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy