Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR241 IGR240 IGR242 IGR239 IGR243 IGR238 IGR246 IGR244 IGR245 dut, - CT292 dcrA, - CT296 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 accD, - CT293 CT289 mrsA,mrsA, - CT295 radA,sms, - CT298 CT288 dut, - CT292 dcrA, - CT296 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 accD, - CT293 CT289 mrsA,mrsA, - CT295 radA,sms, - CT298 CT288 dut, - CT292 dcrA, - CT296 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 accD, - CT293 CT289 mrsA,mrsA, - CT295 radA,sms, - CT298 CT288 rnc, - CT297 rnc, - CT297
* Calculated from Protein Sequence

Gene ID: CT293

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
accD  

Definition:
acetyl-CoA carboxylase subunit beta

Gene Start:
327356

Gene Stop:
326433

Gene Length:
924

Molecular Weight*:
33645

pI*:
7.01

Net Charge*:
0.03

EC:
6.4.1.2  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Carbohydrate Metabolism; Pyruvate metabolism
Lipid Metabolism; Fatty acid biosynthesis

Comment:
The acetyl-CoA carboxlase subunit is part of the hexaheteromeric
enzyme complex that transfers a carboxyl group to the carrier protein
then a transcarboxylation step for malonyl-CoA formation. See CT265
for the alpha subunit. See also CT123 and CT124.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to acetyl-CoA carboxylase subunit beta sequences,
e.g. residues 10-278 are 51% similar to the accD enzyme from H.pylori (AE000604).
Residues 12-278 are 47% similar to ACCD_MARPO. No similarities to T.pallidum or M.genitalium.

CT293 is orthologously related to CPn0058: residues 1-308 of CT293 are 84% similar to residues 1-308 of CPn0058, a predicted acetyl-CoA carboxylase/transferase beta from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0777
COG name: Acetyl-CoA carboxylase beta subunit
Functional Class:  I
The phylogenetic pattern of COG0777 is a--k-qvceBRhuj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 24-122, 125-197, 198-275 are similar to fatty acid biosynthesis ligase
domains as seen in ACCD_HAEIN, ACCD_SYNP7, ACCD_ANGLY.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
113  
136
transmembrane  
209  
229

PDB Hit:
None.

Gene Protein Sequence:
MRLFSYDKPKIKVQKIKADGFSGWLKCTHCSEMIHANELGQNFNCCPKCS
YHYRISVSERIALLADKDSWNPLFSDLRSQDPLNFVDTDTYPNRLEKARK
DNPDSEGVLVGVCTIGSHPVALAVMDFSFMAGSMGAVVGEKLTRLIEKAI
DSRLPVIIVSASGGARMQESVFSLMQMAKTSAALAKLHEAKLPYISVLTN
PTSGGVTASFASLGDVIIAEPKALICFAGPRVVSQVIGEDLPEGAQKSEF
LLEHGMIDKVVERKQLKTTLESLLSFFSCQAYSGGKGNCPRDISKTLKEI
FLLTDDNE

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGTTTATTTTCCTATGATAAACCAAAGATCAAAGTGCAAAAAATAAA
AGCTGATGGCTTCAGTGGCTGGCTAAAATGTACGCATTGTAGCGAAATGA
TTCATGCCAATGAGTTGGGACAGAACTTTAATTGCTGTCCCAAATGTTCG
TACCACTATCGGATTAGTGTTTCGGAACGGATAGCGCTGTTGGCAGATAA
AGATTCATGGAATCCTTTATTTTCGGATTTACGTTCGCAAGACCCTTTGA
ATTTTGTTGATACAGATACTTATCCCAACCGTCTGGAGAAGGCTCGTAAA
GATAATCCTGACAGCGAAGGGGTTTTAGTCGGGGTCTGTACAATCGGAAG
TCATCCTGTTGCTTTAGCTGTTATGGATTTCAGTTTCATGGCTGGTTCCA
TGGGAGCTGTTGTGGGAGAGAAGCTTACTCGTTTGATAGAGAAGGCTATA
GACTCTCGGTTGCCTGTTATCATTGTCTCTGCTTCAGGGGGAGCTAGGAT
GCAGGAGTCTGTTTTTTCCTTAATGCAGATGGCAAAAACATCTGCAGCTT
TGGCTAAGTTACATGAAGCCAAGCTACCTTATATTTCTGTTTTGACAAAC
CCTACTTCTGGGGGAGTTACTGCTTCTTTTGCTTCTTTAGGAGATGTGAT
TATTGCAGAGCCTAAAGCTTTAATTTGTTTCGCTGGACCTCGAGTGGTAT
CTCAGGTGATAGGGGAAGATCTGCCAGAAGGAGCTCAAAAATCTGAATTC
CTATTAGAACATGGGATGATTGATAAGGTAGTAGAGAGAAAACAGCTCAA
AACAACTTTAGAAAGTTTGTTAAGTTTTTTCAGCTGTCAGGCATATTCTG
GAGGCAAAGGTAATTGCCCCAGAGATATCTCTAAGACCCTTAAAGAGATT
TTTTTGTTGACAGATGATAACGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy