Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR241 IGR240 IGR242 IGR239 IGR243 IGR238 IGR246 IGR244 IGR245 IGR237 dut, - CT292 dcrA, - CT296 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 accD, - CT293 ycbF,trmU, - CT287 CT289 mrsA,mrsA, - CT295 rnc, - CT297 CT288 dut, - CT292 dcrA, - CT296 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 accD, - CT293 ycbF,trmU, - CT287 CT289 mrsA,mrsA, - CT295 rnc, - CT297 CT288 dut, - CT292 dcrA, - CT296 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 accD, - CT293 ycbF,trmU, - CT287 CT289 mrsA,mrsA, - CT295 rnc, - CT297 CT288
* Calculated from Protein Sequence

Gene ID: CT292

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dut  

Definition:
deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase)

Gene Start:
326393

Gene Stop:
325959

Gene Length:
435

Molecular Weight*:
15321

pI*:
5.04

Net Charge*:
-3.62

EC:
3.6.1.23  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; pyrimidines  

Pathway: pathway table
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
DUTPase and DUTP pyrophosphatase produces dUMP, a precursor
to all thymidine nucleotides. The E.coli enzyme, typically a
homotrimer, has a characterized 3D structure.


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to DUTPase sequences, e.g,
residues 4-144 are approximately 41% similar to DUT_HAEIN.
Similarities to eukaryotic and viral enzymes. CT292 is similar to TP0885, a
predicted nucleotidohydrolase. No similarity to M.genitalium. Similar to PG852 of P.gingivalis.

CT292 is orthologously related to CPn0059: residues 1-143 are 69%
similar to CPn0059.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0756
COG name: dUTPase
Functional Class:  F
The phylogenetic pattern of COG0756 is ----yq--eBrhuj---linx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 43-143 are 46% similar to a pyrophosphatase DUTP
domain in DUT_LYCES. Residues 13-74 have a match to the
DUTPase domain of DUT_ECOLI.

Paralogs:  Local Blast Search
There is no evidence of paralogs in C.trachomatis, however residues 8-24
are 52% identical to a motif in chlamydial ompB proteins,
e.g., U56924, M61116, X53512.

Pfam Summary:  Pfam Search
Residues 9 to 143 (E-value = 4e-25) place CT292 in the dUTPase family which is described as dUTPase (PF00692)

PDB Hit:
gi|1311150|pdb|1DUP|A Chain A, Deoxyuridine 5'-Triphosphate Nucleotido Hydrolase (D-Utpase) Hydrolase, Nucleotide Metabolism Mol_id: 1; Molecule: Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain: A; Synonym: D-Utpase; Ec: 3.6.1.23

Gene Protein Sequence:
MKFFCKLESGSSLPEYATSGASGADVRANINEPIAILPGQRALIPTGISV
EIPHGYEIQVRSRSGLASKYGVIVLQSPGTVDADYRGEIRVILANLGEAT
FIVEPGMRIAQLVVAKVEQVSFVETQEELTATARGTGGFGHTGEC

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTTTTCTGTAAATTGGAGTCTGGAAGCTCCTTACCCGAGTATGC
TACTTCTGGAGCTTCTGGCGCAGATGTCCGTGCAAATATCAATGAGCCTA
TAGCTATTTTGCCAGGGCAGAGAGCCCTGATTCCTACTGGGATTTCTGTG
GAAATTCCTCATGGGTACGAGATTCAAGTTCGTTCTCGTAGTGGATTAGC
TAGCAAGTACGGCGTTATTGTTCTTCAATCTCCTGGAACTGTCGATGCAG
ATTATCGGGGAGAAATTCGGGTTATTTTAGCAAATCTTGGCGAAGCTACA
TTCATTGTAGAACCCGGAATGCGTATAGCACAGCTTGTTGTAGCAAAGGT
TGAACAAGTGTCTTTTGTCGAAACTCAGGAAGAGTTAACCGCTACGGCGC
GGGGAACCGGTGGATTTGGGCATACTGGGGAATGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy