Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR241 IGR240 IGR242 IGR239 IGR243 IGR238 IGR246 IGR244 IGR245 IGR237 dut, - CT292 dcrA, - CT296 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 accD, - CT293 ycbF,trmU, - CT287 CT289 mrsA,mrsA, - CT295 rnc, - CT297 CT288 dut, - CT292 dcrA, - CT296 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 accD, - CT293 ycbF,trmU, - CT287 CT289 mrsA,mrsA, - CT295 rnc, - CT297 CT288 dut, - CT292 dcrA, - CT296 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 accD, - CT293 ycbF,trmU, - CT287 CT289 mrsA,mrsA, - CT295 rnc, - CT297 CT288
* Calculated from Protein Sequence

Gene ID: CT291

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ptsN  

Definition:
nitrogen regulatory IIa domain protein (PTS IIA)(phosphotransferase)

Gene Start:
325954

Gene Stop:
325481

Gene Length:
474

Molecular Weight*:
17118

pI*:
4.72

Net Charge*:
-7.09

EC:
2.7.1.69  

Functional Class:
central intermediary metabolism; nitrogen metabolism  

Pathway: pathway table
Carbohydrate Metabolism; Fructose and mannose metabolism
Carbohydrate Metabolism; Glycolysis / Gluconeogenesis
Membrane Transport; Phosphotransferase system
Metabolism of Complex Carbohydrates; Starch and sucrose metabolism
Nucleotide Metabolism; Aminosugars metabolism

Comment:
See CT290.

From Prosite PDOC00528:

The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) is a major carbohydrate transport system in bacteria. The PTS catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. The general mechanism of the PTS is the following: a phosphoryl group from phosphoenolpyruvate (PEP) is transferred to enzyme-I (EI) of PTS which in turn transfers it to a phosphoryl carrier protein (HPr). Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease which consists of at least three structurally distinct domains (IIA, IIB, and IIC) which can either be fused together in a single polypeptide chain or exist as two or three interactive chains, formerly called enzymes II (EII) and III (EIII).

The first domain (IIA , carries the first permease-specific phosphorylation site, an histidine which is phosphorylated by phospho-HPr. The second domain (IIB) is phosphorylated by phospho-IIA on a cysteinyl or histidyl residue, depending on the permease. Finally, the phosphoryl group is transferred from the IIB domain to the sugar substrate in a process catalyzed by the IIC domain; this process is coupled to the transmembrane transport of the sugar.


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to PTS IIA sequences, e.g. residues 25-156 are 34%
similar to PTSN_ECOLI. Residues 29-153 are 31% similar to HRSA_ECOLI. CT291 is similar to TP0755 and TP0085 in T.pallidum, predicted PTS IIA components
It is also weakly similar to MG062, a fructose-permease IIBC component in M.genitalium.
CT291 is orthologously related to CPn0060: residues 1-158 are 62% similar to CPn0060.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1762
COG name: Phosphotransferase system mannitol/fructose-specific IIA domain (Ntr-type)
Functional Class:  G,T
The phylogenetic pattern of COG1762 is --------EB-H--gPOLIN-
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
Residues 68-77 are similar to block BL00372 concerned with PTS EIIA domains.

ProDom Summary:  Protein Domain Search
Residues 29-153 and 33-156 are similar to PTS phosphotransferase domains as seen in HRSA_ECOLI and
PTVA_ECOLI.

Paralogs:  Local Blast Search
CT291 is weakly paralogous to CT290, a predicted PTS IIA protein.

Pfam Summary:  Pfam Search
Residues 15 to 158 (E-value = 8.2e-16) place CT291 in the PTS_EIIA_2 family which is described as Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 (PF00359)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
158

PDB Hit:
none

Gene Protein Sequence:
MTCVADHKQAVTLSSLLSSDLITFLHSDTREDILFELSELAARAGLLEDR
EAFFRALLARENIMSTGIGMGVAIPHGKIDGSADFFIALGIHSEGILWDA
IDGLSVRLVFLIGGPSDAPSKYLKLLSALTQSLRDEARRSQLLQVQTVEE
VMSVFSGV

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTTGCGTTGCTGACCATAAGCAAGCTGTTACTTTAAGTTCGTTACT
TTCATCAGATTTAATCACTTTCTTACATTCAGATACTAGAGAAGATATCC
TTTTTGAACTTTCGGAGCTAGCTGCCAGAGCTGGGTTACTGGAAGATAGG
GAGGCTTTCTTTCGTGCTCTATTGGCAAGAGAGAATATTATGTCTACAGG
TATCGGTATGGGAGTAGCTATTCCTCATGGGAAAATCGATGGGAGTGCAG
ATTTTTTTATTGCTCTAGGCATCCATTCAGAGGGTATTTTGTGGGATGCT
ATAGACGGGTTGTCTGTGCGGCTTGTTTTTCTTATTGGAGGGCCATCTGA
TGCCCCTTCGAAATATCTGAAACTGTTATCGGCATTAACACAATCTTTGC
GAGATGAAGCCAGAAGATCACAACTCTTACAAGTGCAAACTGTTGAAGAA
GTTATGAGTGTTTTTTCAGGAGTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy