Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR241 IGR240 IGR242 IGR239 IGR243 IGR238 IGR244 IGR245 IGR237 dut, - CT292 dcrA, - CT296 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 accD, - CT293 ycbF,trmU, - CT287 CT289 mrsA,mrsA, - CT295 CT288 clpC, - CT286 dut, - CT292 dcrA, - CT296 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 accD, - CT293 ycbF,trmU, - CT287 CT289 mrsA,mrsA, - CT295 CT288 clpC, - CT286 dut, - CT292 dcrA, - CT296 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 accD, - CT293 ycbF,trmU, - CT287 CT289 mrsA,mrsA, - CT295 CT288 clpC, - CT286
* Calculated from Protein Sequence

Gene ID: CT290

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ptsN  

Definition:
nitrogen regulatory IIa protein

Gene Start:
325475

Gene Stop:
324801

Gene Length:
675

Molecular Weight*:
25759

pI*:
5.40

Net Charge*:
-7.87

EC:
2.7.1.69  

Functional Class:
central intermediary metabolism; nitrogen metabolism  

Pathway: pathway table
Carbohydrate Metabolism; Fructose and mannose metabolism
Carbohydrate Metabolism; Glycolysis / Gluconeogenesis
Membrane Transport; Phosphotransferase system
Metabolism of Complex Carbohydrates; Starch and sucrose metabolism
Nucleotide Metabolism; Aminosugars metabolism

Comment:
This protein is not fully understood but is thought to have some role
in coupling carbon and nitrogen assimilation. See CT291. This gene
tentatively designated ptsN.

From Prosite PDOC00528:

The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) is a major carbohydrate transport system in bacteria. The PTS catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. The general mechanism of the PTS is the following: a phosphoryl group from phosphoenolpyruvate (PEP) is transferred to enzyme-I (EI) of PTS which in turn transfers it to a phosphoryl carrier protein (HPr). Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease which consists of at least three structurally distinct domains (IIA, IIB, and IIC) which can either be fused together in a single polypeptide chain or exist as two or three interactive chains, formerly called enzymes II (EII) and III (EIII).

The first domain (IIA , carries the first permease-specific phosphorylation site, an histidine which is phosphorylated by phospho-HPr. The second domain (IIB) is phosphorylated by phospho-IIA on a cysteinyl or histidyl residue, depending on the permease. Finally, the phosphoryl group is transferred from the IIB domain to the sugar substrate in a process catalyzed by the IIC domain; this process is coupled to the transmembrane transport of the sugar.


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to nitrogen regulatory IIA protein sequences,
e.g., residues 75-221 are 29% similar to PTSN_ECOLI. CT290 is weakly similar
to TP0755 of T.pallidum, a predicted PTS system component. It is also
weakly similar to MG062 of M.genitalium, a predicted fructose-permease
IIBC component.
CT290 is orthologously related to CPn0061: residues 1-225 are 66% similar to CPn0061.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1762
COG name: Phosphotransferase system mannitol/fructose-specific IIA domain (Ntr-type)
Functional Class:  G,T
The phylogenetic pattern of COG1762 is --------EB-H--gPOLIN-
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 117-182 are 43% similar to domains seen in phophotransferase enzyme
II sequences, e.g., PTSN_HAEIN (in agreement with the BLAST summary).
Residues 92-187 also support this assignment, as shown by the similarity to
PTFB_MYCGE.

Paralogs:  Local Blast Search
Residues 111-181 suggest a paralogous relationship to CT291, also thought to be a member of the IIa domain family.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MDLRLDQLAVLLDVAEDSIRQWVSCGGIPSYTINDELRFNREEVEDWLIH
NHGVILDEKREEKGESKDLSLRYSLYRAIYRGGVLKNVLVDSKEGALRYA
AHYIANKFELDPVVLFEMLMHRESLMSTGIGEGIALPHAKDFLINVGYDI
IVPVFLSQSIEYGALDGKPVDTLFFLFANQDRNHLNLVNKIVHLGMSIQA
RLFLKEHPDQPQLLAFVKNWEAQIH

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTTGCGATTAGATCAGTTAGCTGTATTATTGGATGTAGCAGAAGA
TTCTATCCGACAGTGGGTATCTTGTGGAGGAATCCCTAGTTACACGATTA
ACGATGAGTTGCGTTTCAATAGAGAAGAAGTGGAAGACTGGCTTATCCAC
AATCATGGGGTTATTCTAGATGAAAAACGAGAGGAAAAAGGGGAGTCCAA
GGATTTGTCACTTAGATATAGCCTATATCGAGCTATTTATAGGGGAGGGG
TTCTAAAAAATGTTCTTGTAGATAGTAAGGAAGGCGCCCTACGGTATGCT
GCTCATTATATAGCTAATAAGTTCGAGTTGGATCCGGTAGTTCTATTCGA
GATGCTTATGCATCGGGAAAGTCTTATGTCTACAGGTATCGGAGAGGGAA
TTGCTTTACCTCATGCTAAGGACTTCTTGATTAACGTTGGGTACGATATT
ATTGTTCCCGTTTTCTTATCTCAAAGCATTGAATATGGAGCGCTTGACGG
TAAGCCTGTTGATACTCTGTTCTTCTTATTCGCTAATCAAGATAGAAATC
ATTTGAATCTTGTGAATAAAATCGTGCACTTAGGCATGTCTATTCAAGCT
CGACTCTTTCTTAAGGAGCATCCGGATCAGCCACAGCTTTTAGCTTTTGT
TAAAAATTGGGAAGCTCAAATTCAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy