Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR241 IGR240 IGR242 IGR239 IGR243 IGR238 IGR237 IGR236 dut, - CT292 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 lplA, - CT285 accD, - CT293 ycbF,trmU, - CT287 CT289 CT288 clpC, - CT286 dut, - CT292 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 lplA, - CT285 accD, - CT293 ycbF,trmU, - CT287 CT289 CT288 clpC, - CT286 dut, - CT292 ptsN, - CT291 sodA,sodM, - CT294 ptsN, - CT290 lplA, - CT285 accD, - CT293 ycbF,trmU, - CT287 CT289 CT288 clpC, - CT286
* Calculated from Protein Sequence

Gene ID: CT288

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
321823

Gene Stop:
323511

Gene Length:
1689

Molecular Weight*:
63089

pI*:
7.99

Net Charge*:
5.43

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CT288 is similar to CPn0065: residues 13-512 of CT288 are 23% similar to residues 11-503 of CPn0065, a predicted Chlamydia-specific hypothetical protein from C. pneumoniae. No similarity to T. pallidum or M. genitalium.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
Residues 37-54, 40-57, 243-260 are similar to blocks PR00211A, concerned with
glutelin signature sequences.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
39  
61
transmembrane  
65  
85
transmembrane  
247  
266
transmembrane  
270  
288
coil-coil  
353  
391
coil-coil  
404  
443
coil-coil  
535  
563

PDB Hit:
None.

Gene Protein Sequence:
MVYFRAHQPRHTPKTFPLEVHHSFSDKHPQIAKAMRITGIALAALSLLAV
VACVIAVSAGGAAIPLAVISGIAVMSGLLSAATIICSAKKALAQRKQKQL
EESLPLDNATEHVSYLTSDTSYFNQWESLGALNKQLSQIDLTIQAPEKKL
LKEVLGSRYDSINHSIEEISDRFTKMLSLLRLREHFYRGEERYAPYLSPP
LLNKNRLLTQITSNMIRMLPKSGGVFSLKANTLSHASRTLYTVLKVALSL
GVLAGVAALIIFLPPSLPFIAVIGVSSLALGMASFLMIRGIKYLLEHSPL
NRKQLAKDIQKTIGPDVLASMVHYQHQLLSHLHETLLDEAITARWSEPFF
IEHANLKAKIEDLTKQYDILNAAFNKSLQQDEALRSQLEKRAYLFPIPNN
DENAKTKESQLLDSENDSNSEFQEIINKGLEAANKRRADAKSKFYTEDET
SDKIFSIWKPTKNLALEDLWRVHEACNEEQQALLLEDYMSYKTSECQAAL
QKVSQELKAAQKSFAVLEKHALDRSYESSVATMDLARANQETHRLLNILS
ELQQLAQYLLDNH

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTTATTTTAGAGCTCATCAACCTAGGCATACGCCTAAAACATTTCC
TTTGGAAGTTCACCATTCGTTCTCCGATAAGCATCCTCAAATTGCTAAAG
CTATGCGGATTACGGGGATAGCCCTCGCAGCTCTATCTCTGCTCGCTGTA
GTCGCCTGCGTTATTGCCGTCTCTGCGGGAGGAGCTGCCATTCCTCTTGC
TGTCATTAGTGGAATTGCTGTAATGTCTGGCCTCTTATCCGCTGCCACCA
TTATCTGTTCTGCAAAAAAGGCTTTGGCTCAACGAAAACAAAAACAACTA
GAAGAGTCGCTTCCGTTAGATAATGCGACCGAGCATGTGAGTTACCTGAC
CTCAGACACCTCTTATTTTAATCAATGGGAATCCTTAGGTGCTCTAAATA
AGCAGTTGTCTCAGATTGACTTAACTATTCAAGCTCCCGAAAAAAAACTA
TTAAAAGAAGTTCTTGGTTCCAGATACGATTCCATTAATCACTCCATCGA
AGAGATCTCCGATCGCTTTACGAAAATGCTCTCTCTTCTTCGATTAAGAG
AACATTTTTATCGAGGAGAAGAGCGTTATGCCCCCTATTTAAGCCCTCCT
CTACTTAACAAGAATCGTTTGCTGACCCAAATCACATCCAATATGATTAG
GATGCTACCAAAATCCGGTGGTGTTTTTTCCCTCAAAGCCAATACACTAA
GTCATGCCAGCCGCACACTATATACAGTATTAAAAGTCGCTTTATCCTTA
GGAGTTCTCGCTGGAGTCGCTGCTCTTATCATCTTTCTTCCCCCTAGCCT
GCCTTTTATCGCTGTTATAGGAGTATCTTCCTTAGCATTGGGGATGGCAT
CTTTCCTTATGATTCGGGGCATTAAGTATTTGCTCGAACATTCTCCTCTG
AATAGAAAGCAACTAGCTAAAGATATTCAAAAAACCATTGGCCCAGATGT
CTTGGCCTCTATGGTTCATTACCAGCATCAATTACTATCACATCTACATG
AAACTCTATTAGATGAAGCCATCACAGCTAGATGGAGCGAGCCCTTCTTT
ATTGAACACGCTAATCTTAAGGCAAAAATTGAAGATTTGACAAAACAATA
TGATATATTGAACGCAGCCTTTAATAAATCTTTACAACAAGATGAGGCGC
TCCGTTCTCAATTAGAGAAACGAGCTTACTTATTCCCAATTCCTAATAAC
GACGAAAATGCTAAAACTAAAGAATCGCAGCTTCTAGACTCAGAAAATGA
TTCAAATTCTGAATTTCAGGAGATTATAAATAAAGGACTAGAAGCTGCCA
ATAAACGACGAGCTGACGCTAAGTCAAAATTCTATACGGAAGACGAAACC
TCTGACAAAATATTCTCTATATGGAAACCCACAAAGAACTTGGCATTAGA
AGATTTGTGGAGAGTGCATGAAGCTTGCAATGAAGAGCAACAAGCTCTCC
TCTTAGAAGATTATATGAGTTATAAAACCTCAGAATGTCAAGCTGCACTC
CAAAAAGTGAGTCAAGAACTGAAGGCGGCACAAAAATCATTCGCAGTCCT
AGAAAAGCATGCTCTAGACAGATCTTATGAATCCAGTGTAGCCACGATGG
ATTTAGCTAGAGCGAATCAAGAAACACACCGGCTTCTGAACATCCTCTCT
GAATTACAACAACTAGCACAATACCTGTTAGATAATCAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy