Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR241 IGR240 IGR235 IGR239 IGR238 IGR237 IGR236 dut, - CT292 ptsN, - CT291 ptsN, - CT290 lplA, - CT285 ycbF,trmU, - CT287 CT289 CT284 CT288 clpC, - CT286 dut, - CT292 ptsN, - CT291 ptsN, - CT290 lplA, - CT285 ycbF,trmU, - CT287 CT289 CT284 CT288 clpC, - CT286 ptsN, - CT291 ptsN, - CT290 lplA, - CT285 ycbF,trmU, - CT287 CT289 CT284 dut, - CT292 CT288 clpC, - CT286
* Calculated from Protein Sequence

Gene ID: CT287

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ycbF  trmU  

Definition:
probable tRNA-(5-methylaminomethyl-2-thiouridylate) methyltransferase, TrmU.

Gene Start:
321591

Gene Stop:
320518

Gene Length:
1074

Molecular Weight*:
40172

pI*:
7.54

Net Charge*:
1.80

EC:
2.1.1.61  

Functional Class:
translation; tRNA modification  

Pathway: pathway table

Comment:
In E.coli this enzyme adds SAM to tRNA to yield a modified tRNA. Consider
also PP-loop ATPase function.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to tRNA-(5-methylaminomethyl-2-thiouridylate) methyltransferases, TRMU
sequences, e.g. residues 2-351 are 53% similar to TRMU_BACSU. Residues
3-350 are 48% similar to TRMU_HAEIN. Residues 5-350 are 33% similar to a conserved hypothetical protein in B.burgdorferi
(AE001169). Residues 3-350 are 38% similar to Y295_MYCGE. No similarity to T.pallidum. Similar to PG240 of P.gingivalis.

CT287 is orthologously related to CPn0438: residues of 1-355 of CT287 are 70%
similar to residues 1-357 CPn0438, a probable member of the PP-loop ATPase family, YcbF,
from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0482
COG name: Predicted ATPase of the PP-family
Functional Class:  R
The phylogenetic pattern of COG0482 is ----yQvcebrhUJgpo-inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 4-23, 98-136, 179-198 are similar to blocks of uncharacterized proteins,
BL01263B,D, e.g. YB57_METJA. Residues 5-41 have similarity to block BL00564A
concerned with arginosuccinate synthase, e.g. ASSY_YEAST. Residues 96-106 are similar
to block BL00726B concerned with AP endonucleases, e.g. APEA_DICDI.

ProDom Summary:  Protein Domain Search
Residues 3-350 are 48% similar to a hypothetical domain of YCFB_HAEIN.

Paralogs:  Local Blast Search
No paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 3 to 350 (E-value = 5.8e-224) place CT287 in the tRNA_Me_trans family which is described as tRNA methyl transferase (PF03054)

PDB Hit:
none

Gene Protein Sequence:
MRKTVIVAMSGGVDSSVVAYLLKKQGEYNVVGLFMKNWGEQDENGECTAT
KDFRDVERIAEQLSIPYYTVSFSKEYKERVFSRFLREYANGYTPNPDVLC
NREIKFDLLQKKVRELKGDFLATGHYCRGGADGTGLSRGIDPNKDQSYFL
CGTPKDALSNVLFPLGGMYKTEVRRIAQEAGLATATKKDSTGICFIGKRP
FKSFLEQFVADSPGDIIDFDTQQVVGRHEGAHYYTIGQRRGLNIGGMEKP
CYVLSKNMEKNIVYIVRGEDHPLLYRQELLAKELNWFVPLQEPMICSAKV
RYRSPDEKCSVYPLEDGTVKVIFDVPVKAVTPGQTVAFYQGDICLGGGVI
EVPMIHQL

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGTAAAACTGTCATTGTTGCTATGTCTGGAGGAGTGGATTCCTCGGT
TGTTGCTTATCTCTTAAAGAAGCAAGGGGAGTATAATGTTGTTGGGCTCT
TCATGAAAAATTGGGGAGAGCAGGACGAGAATGGTGAGTGTACTGCAACC
AAAGATTTTCGCGATGTAGAGCGGATCGCAGAACAATTGTCCATTCCATA
TTACACAGTTTCCTTTTCTAAGGAATATAAAGAGCGAGTGTTTTCTAGAT
TTCTAAGAGAATATGCGAACGGCTACACTCCCAATCCTGATGTGTTATGC
AATCGAGAAATCAAATTTGATTTATTACAGAAGAAGGTACGTGAGCTAAA
AGGTGATTTTTTAGCCACGGGACATTATTGTCGAGGAGGGGCTGATGGAA
CTGGTTTGTCCAGAGGAATAGACCCCAATAAAGACCAAAGTTATTTCTTA
TGTGGCACTCCTAAGGATGCTTTATCCAATGTACTTTTCCCCCTGGGAGG
TATGTATAAAACGGAGGTACGTCGAATTGCTCAAGAAGCTGGTTTAGCTA
CCGCCACAAAAAAAGATAGCACAGGGATTTGCTTCATTGGTAAACGGCCT
TTTAAGAGTTTCCTTGAGCAGTTTGTAGCAGACTCTCCTGGAGACATTAT
TGATTTTGATACACAACAGGTAGTCGGCCGACATGAAGGAGCCCATTATT
ATACGATTGGACAGCGTCGAGGGTTAAACATAGGAGGAATGGAAAAGCCT
TGTTATGTTCTTAGCAAGAATATGGAAAAGAATATTGTTTACATTGTAAG
GGGTGAAGATCATCCTTTACTTTATCGACAAGAGCTTTTAGCTAAGGAAC
TTAATTGGTTTGTTCCCTTGCAGGAGCCTATGATCTGTAGTGCTAAAGTT
CGGTACAGATCCCCTGACGAGAAATGTTCTGTATATCCTTTGGAAGATGG
AACGGTAAAAGTGATTTTCGATGTCCCTGTGAAAGCTGTCACCCCTGGAC
AGACTGTAGCTTTCTACCAGGGGGACATTTGTTTAGGAGGAGGAGTGATT
GAAGTGCCTATGATTCATCAGCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy