Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR235 IGR233 IGR232 IGR234 IGR237 IGR236 gcsH,gcvT, - CT282 lplA, - CT285 ycbF,trmU, - CT287 CT284 CT283 nqr5, - CT281 CT288 clpC, - CT286 gcsH,gcvT, - CT282 lplA, - CT285 ycbF,trmU, - CT287 CT284 CT283 nqr5, - CT281 CT288 clpC, - CT286 gcsH,gcvT, - CT282 lplA, - CT285 ycbF,trmU, - CT287 CT284 CT283 nqr5, - CT281 CT288 clpC, - CT286
* Calculated from Protein Sequence

Gene ID: CT285

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lplA  

Definition:
lipoate-protein ligase

Gene Start:
317705

Gene Stop:
316989

Gene Length:
717

Molecular Weight*:
26770

pI*:
9.14

Net Charge*:
4.11

EC:
 

Functional Class:
translation; protein modification  

Pathway: pathway table

Comment:
See CT499.

Blast Summary:  PSI-Blast Search
One significant hit in gapped-BLAST to a hypothetical protein
from B. subtilis: residues 4-178 are 27% similar to the sequence
Z99116. No similarities to T.pallidum or M.genitalium.

CT285 is orthologously related CPn0436 and they
share 53% similarity.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0095
COG name: Lipoate-protein ligase A
Functional Class:  H
The phylogenetic pattern of COG0095 is ---kyQvceB----gp--IN-
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 80-178 are 28% similar to a hypothetical protein domain
represented by YQHM_BACSU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 47 to 184 (E-value = 2.3e-28) place CT285 in the BPL_LipA_LipB family which is described as Biotin/lipoate A/B protein ligase family (PF03099)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
212  
239

PDB Hit:
none

Gene Protein Sequence:
MRTRVIDSIRGTPKDLMQKDRLLLDSLRKGEVILHLYEWEGIFPLTYGCF
IKPERFLKANWESLGVSAASRPTGGGVTFHNSDYAFSLLVSSEHPLYQDS
ILANYHTVNRFVLKTINKLFGLEGSLSPIEVSTDRAESSNFCVAKTSKYD
VLIGNRKVGGAAQRSVKQGFLHQGSIFLSGNSLDFYRNILLPDLVDKIGP
EIEKSAFFPLGMEASSTVLKEVRKEVKDSLMRIFMQEGI

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAACGCGTGTCATTGATTCTATTAGAGGAACTCCTAAAGATCTCAT
GCAAAAGGATCGTTTGCTTCTAGACTCTTTAAGAAAGGGAGAAGTCATTC
TTCATTTGTATGAGTGGGAAGGGATTTTCCCTTTGACTTATGGATGCTTT
ATTAAGCCTGAGAGATTCTTAAAGGCTAACTGGGAATCTTTAGGAGTAAG
CGCTGCAAGTCGTCCGACAGGTGGTGGTGTTACATTTCATAATAGTGATT
ACGCGTTCTCGCTTCTGGTGTCTTCAGAACATCCCTTATATCAAGACTCT
ATCCTGGCGAACTATCATACGGTCAATCGTTTTGTTCTGAAGACAATCAA
TAAATTATTTGGATTGGAAGGTTCGTTATCACCCATTGAAGTATCGACTG
ATCGAGCAGAGTCTTCTAATTTTTGTGTGGCAAAAACTTCTAAATACGAC
GTTCTTATAGGAAATAGAAAAGTAGGAGGAGCGGCTCAAAGGTCTGTGAA
ACAAGGCTTTTTGCATCAGGGCTCTATCTTTCTATCTGGTAATTCTCTTG
ATTTCTATCGAAATATTTTGCTTCCAGACCTTGTGGATAAGATCGGACCT
GAGATAGAGAAGAGTGCTTTTTTCCCATTAGGGATGGAAGCATCCTCAAC
AGTATTAAAAGAAGTTAGAAAAGAGGTTAAAGACTCTTTGATGCGGATCT
TTATGCAGGAGGGGATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy