Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR235 IGR231 IGR233 IGR232 IGR234 IGR236 gcsH,gcvT, - CT282 lplA, - CT285 ycbF,trmU, - CT287 CT284 CT283 nqr5, - CT281 CT279 clpC, - CT286 gcsH,gcvT, - CT282 lplA, - CT285 ycbF,trmU, - CT287 CT284 CT283 nqr5, - CT281 CT279 clpC, - CT286 gcsH,gcvT, - CT282 lplA, - CT285 ycbF,trmU, - CT287 CT284 CT283 nqr5, - CT281 clpC, - CT286 nqr4, - CT280 CT279 nqr4, - CT280
* Calculated from Protein Sequence

Gene ID: CT284

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible phospholipase D HKD-related protein

Gene Start:
316980

Gene Stop:
315559

Gene Length:
1422

Molecular Weight*:
54305

pI*:
6.00

Net Charge*:
-6.98

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
See CT084, CT154, CT155, CT156, CT157, and CT158.

Blast Summary:  PSI-Blast Search
Weak matches in gapped BLAST to hypothetical proteins: residues 269-453 are 23% similar and residues 42-162 are 25% similar to YWNE_BACSU.
Residues 32-451 are 22% similar to YLP2_PSEPU. No similarity to T.pallidum or M.genitalium.

CT284 is orthologously related to CPn0435: residues 6-474 of CT284
are 42% similar to residues 9-476 of CPn0435, a predicted conserved
hypothetical protein (possible phospholipase D HKD-related
protein) from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1502
COG name: Cardiolipin synthase, phoaphatidylserine synthase and related enzymes of the phospholipase D family
Functional Class:  I
The phylogenetic pattern of COG1502 is a---y-vcEB-hUJ----INx
Number of proteins in this genome belonging to this COG is 7


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 34-162, 272-354, 391-451 are similar to transferase domains as observed
in YWJE_BACSU, YWIE_BACSU, YLP2_PSEPU.

Paralogs:  Local Blast Search
No paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram positive/gram negative signal  
1  
23

PDB Hit:
None.

Gene Protein Sequence:
MKMAFLRKIFVFVACVVSLNGFAHTIAIPDGDKKAKVLIHDNGYEMYEHL
LAAISSAKYTVELCPCLAGGEILSTVLQRLEQRMEEVPALVSYILVQPTC
IDDNDRKNLKTLQENYPDRFFYLFSDWPPYCNVFFPNVTESHTKLSIVDG
KYIFIGGSNLEDLQCSKGDVDLEVSDSPRAVIGGVLRPSAMRDQDVTIVS
EEYGALLRKEFCAHYALWKDFTQKLWLNKKLDDFRGIDPINLSIEKARSS
FCAMIETSLCAVSVPLDKMHFIFSGPDESNNTIAEEYVRLINQAQHSIRI
AQMFFIPVAKIYDSLMAACWDRGVEIYLVTNGRTDRSPEITRSYAWGNRI
NYFPLTFGSRPLLWERFLYSPSRASMKFYVSEFYVANTQLHKKCMLVDDH
ILVIGSYNFGKKSNDCDYECIVVIDSKEAVSKAQVVFEKDLRLSKSVTHD
DIINWYFDPVHYCLGYLEQRYMPS

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATGGCTTTTTTACGGAAAATATTTGTATTTGTAGCTTGTGTTGT
CTCGTTGAATGGTTTTGCACACACTATAGCTATTCCGGATGGAGACAAAA
AAGCTAAGGTTCTTATTCATGATAACGGCTATGAAATGTACGAACACCTG
TTGGCCGCTATTAGTAGTGCTAAATATACTGTAGAATTGTGTCCTTGTTT
AGCAGGAGGAGAGATTTTATCCACAGTTCTTCAGCGCTTGGAGCAGCGTA
TGGAAGAAGTGCCTGCGCTTGTAAGCTACATATTGGTCCAACCTACATGT
ATTGATGATAATGATCGGAAGAATTTAAAAACTCTGCAAGAAAATTATCC
TGACAGGTTTTTCTACCTGTTTTCAGATTGGCCACCGTATTGTAATGTAT
TTTTCCCTAACGTGACAGAGTCGCATACTAAGTTGTCCATTGTTGATGGG
AAGTACATTTTTATCGGAGGTTCAAATTTAGAGGATCTTCAATGTTCTAA
AGGGGATGTGGATTTAGAAGTCTCTGATTCCCCTCGTGCTGTGATAGGAG
GAGTGCTTCGGCCTTCAGCTATGCGAGATCAAGATGTAACGATTGTCTCG
GAAGAATATGGAGCATTGCTGAGAAAAGAATTTTGTGCTCACTATGCTTT
GTGGAAGGATTTCACTCAAAAACTATGGTTAAACAAAAAATTAGATGATT
TTAGAGGCATTGATCCAATCAATCTTTCTATAGAAAAAGCTAGATCCTCT
TTCTGTGCTATGATTGAGACGAGCCTTTGTGCTGTATCTGTACCTTTAGA
TAAAATGCATTTTATCTTTTCCGGACCGGATGAATCGAACAACACGATTG
CTGAAGAATATGTTCGGCTGATTAACCAAGCTCAACATTCTATCCGGATA
GCGCAGATGTTTTTTATTCCGGTAGCGAAAATATATGATAGTCTCATGGC
TGCTTGCTGGGATAGAGGCGTAGAAATCTATTTAGTAACCAATGGGAGAA
CGGATCGGAGTCCCGAAATCACTAGAAGCTATGCTTGGGGAAATCGAATT
AATTATTTCCCATTGACTTTCGGTTCTCGGCCGCTTTTGTGGGAACGCTT
TTTGTATTCTCCCAGTCGAGCCTCTATGAAGTTTTATGTGAGCGAGTTTT
ATGTAGCTAATACACAACTGCATAAAAAGTGCATGCTTGTAGATGATCAT
ATTTTAGTTATAGGCAGTTACAATTTTGGAAAGAAGAGTAACGATTGCGA
TTACGAATGCATTGTGGTGATTGATTCAAAAGAAGCAGTCTCTAAAGCTC
AGGTAGTATTTGAAAAAGATTTGCGACTTTCTAAATCAGTGACTCATGAT
GACATTATAAACTGGTATTTTGATCCTGTACATTATTGTTTAGGGTACTT
AGAACAGAGATACATGCCATCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy