Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR230 IGR235 IGR231 IGR233 IGR232 IGR234 IGR236 gcsH,gcvT, - CT282 CT277 lplA, - CT285 CT284 CT283 CT276 nqr5, - CT281 CT279 nqr2, - CT278 clpC, - CT286 gcsH,gcvT, - CT282 CT277 lplA, - CT285 CT284 CT283 CT276 nqr5, - CT281 CT279 nqr2, - CT278 clpC, - CT286 gcsH,gcvT, - CT282 CT277 lplA, - CT285 CT284 CT283 CT276 nqr5, - CT281 CT279 nqr2, - CT278 clpC, - CT286 nqr4, - CT280 nqr4, - CT280
* Calculated from Protein Sequence

Gene ID: CT282

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gcsH  gcvT  

Definition:
glycine cleavage H protein (glycine decarboxylase component)

Gene Start:
313269

Gene Stop:
312919

Gene Length:
351

Molecular Weight*:
13127

pI*:
4.62

Net Charge*:
-8.09

EC:
 

Functional Class:
amino acid biosynthesis; serine-glycine family  

Pathway: pathway table

Comment:
This enzyme typically resides in mitochondria and is
responsible for the degradation of glycine. In E.coli, the cleavage system
is constituted from P,T,L, and H components, with the H protein conveying
the methylamine group of glycine from the P to the T proteins. P (EC 1.4.4.2)and
T (EC 2.1.2.10) components (or a glycine cleavage system operon) have not been located in C.trachomatis:
the L protein function might be served by CT557, a putative pyruvate dehydrogenase,
component analogous to the role of the E.coli L component.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to glycine cleavage H system sequences,
e.g., residues 1-114 are 27% similar to GCSH_FLAPR. No similarities to T.pallidum or
M.genitalium. Similar to PG848 or P.gingivalis.

CT282 is orthologously related to CPn0433: residues 6-115 are 58% similar
to CPn0433.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0509
COG name: Glycine cleavage system H protein (lipoate-binding)
Functional Class:  E
The phylogenetic pattern of COG0509 is ---kyQvcebr-------in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 44-78 correspond to block BL00189A, which encompasses
2-oxo acid dehydrogenase sequences, e.g., ODO2-YEAST.

ProDom Summary:  Protein Domain Search
Residues 24-112 are 33% similar to a protein H system domain
observed in GCSH_ECOLI. Also, residues 44-75 correspond to a
OF E2 dehydrogenase domain of ODO2_YEAST.

Paralogs:  Local Blast Search
While there is no evidence of paralogs in
C. trachomatis, residues 5-85 of CT282 are 38% similar
to a stretch of CT123, thought to be a biotin carboxylase
carrier protein.

Pfam Summary:  Pfam Search
Residues 5 to 113 (E-value = 8.9e-12) place CT282 in the GCV_H family which is described as Glycine cleavage H-protein (PF01597)

PDB Hit:
gi|999900|pdb|1HTP| H-Protein (E.C.1.4.4.2) Complexed With Lipoic Acid Charged In Methylamine

Gene Protein Sequence:
MKGKKYYSDYHVWIEPIHSRIVKLGLSSQMREHLGNILHIDLPSLGAFIK
EGEKLCILESSKSAIEVLSPVSGEVLEVNTALEDDILPVNNATESEGWFV
VLQLTEDFRSESFSLEP

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGGGAAAAAATATTATTCTGACTATCATGTATGGATAGAACCTAT
TCATTCTCGAATAGTAAAACTTGGTTTATCATCTCAAATGCGAGAGCATT
TAGGGAATATCTTGCACATAGATCTGCCTTCTTTAGGAGCTTTTATTAAA
GAAGGAGAAAAGCTTTGCATTTTAGAATCTTCAAAGTCAGCTATTGAGGT
TCTTTCTCCTGTTTCTGGAGAGGTGTTGGAGGTCAATACAGCTCTTGAAG
ATGATATTCTTCCTGTTAATAATGCCACAGAATCAGAAGGATGGTTTGTG
GTTCTACAACTCACCGAAGATTTCCGCAGCGAAAGCTTTTCTTTAGAACC
C


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy