Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR224 IGR230 IGR231 IGR226 IGR233 IGR232 IGR228 IGR227 IGR225 gcsH,gcvT, - CT282 CT277 CT272 penA,pbp, - CT270 CT283 CT274 CT273 CT276 nqr5, - CT281 CT279 dnaA, - CT275 nqr2, - CT278 gcsH,gcvT, - CT282 CT277 CT272 penA,pbp, - CT270 CT283 CT274 CT273 CT276 nqr5, - CT281 CT279 dnaA, - CT275 nqr2, - CT278 CT277 CT272 CT283 CT271 penA,pbp, - CT270 gcsH,gcvT, - CT282 CT271 CT273 CT276 nqr5, - CT281 CT279 dnaA, - CT275 nqr2, - CT278 nqr4, - CT280 nqr4, - CT280 CT274
* Calculated from Protein Sequence

Gene ID: CT277

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (basic)

Gene Start:
309054

Gene Stop:
308398

Gene Length:
657

Molecular Weight*:
25414

pI*:
9.94

Net Charge*:
17.76

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
this is a new record hypothetical protein

Blast Summary:  PSI-Blast Search
CT277 is weakly similar to CPn0427, a Chlamydia-specific hypothetical protein: residues 39-215 are 29% similar to CPn0427.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
Residues 114-122 are matched to a fibronectin type I repeat, block
PR00012B (e.g. FINC_CHICK). Residues 204-219 show weak similarity to block
PR00167A, concerned with calcium channel signatures, e.g. CIC1_RABIT.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
25  
48
transmembrane  
83  
101

PDB Hit:
none

Gene Protein Sequence:
MSERKVENVTRSKRNKLLKFLRIKNSVVYRILIFVIRQIFPVLCCICKAP
GREICLSCWRRCSKRIYDNRCTRCLETLNIGEISAICSTCSALSPHLSLY
LYELMPETLALYRCACLGNRSGEQSFSKAALRALILNQCSIDRIIFSSKD
IERNIVESIARYLKVPCEKRSWYRKRKALDSAENICILSIYPFNRRVREE
IFSQVPDNAIFMSLFPLAH

Gene Nucleotide Sequence:  Sequence Viewer
GTGTCTGAGAGAAAGGTTGAGAACGTTACACGTTCAAAACGTAACAAATT
ATTAAAATTTTTACGAATAAAAAACTCGGTTGTTTATAGGATTCTAATAT
TTGTTATTCGACAAATATTTCCGGTCCTTTGCTGCATTTGTAAAGCTCCA
GGAAGAGAGATTTGTCTATCTTGTTGGCGGCGATGTAGTAAACGTATTTA
CGATAATCGTTGTACTAGGTGTTTAGAAACGTTGAATATAGGGGAGATTT
CGGCGATCTGTTCTACTTGTTCAGCCTTATCTCCGCATCTCTCTTTATAT
TTGTATGAGCTTATGCCTGAGACATTAGCTTTATATCGTTGCGCATGTTT
AGGGAATAGAAGTGGAGAGCAGAGTTTCTCGAAAGCTGCTTTGAGAGCTC
TAATACTAAATCAGTGCTCAATTGATCGGATTATCTTTTCTTCAAAAGAC
ATAGAGAGAAACATTGTGGAGTCTATAGCCAGATATTTGAAAGTTCCTTG
CGAAAAGAGATCTTGGTATAGGAAAAGAAAAGCTTTAGACTCAGCAGAAA
ACATATGCATTCTTTCTATTTATCCTTTTAATAGAAGAGTGCGCGAAGAA
ATTTTTAGCCAAGTACCTGACAACGCGATTTTTATGAGTCTATTTCCTCT
TGCTCAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy