Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR224 IGR226 IGR228 IGR222 IGR227 IGR225 IGR223 ihfA, - CT267 CT277 CT272 murE, - CT269 penA,pbp, - CT270 CT274 CT273 CT276 dnaA, - CT275 ihfA, - CT267 CT277 CT272 murE, - CT269 penA,pbp, - CT270 CT274 CT273 CT276 dnaA, - CT275 ihfA, - CT267 CT277 CT272 murE, - CT269 penA,pbp, - CT270 CT271 amiA, - CT268 CT271 amiA, - CT268 CT273 CT276 dnaA, - CT275 CT274
* Calculated from Protein Sequence

Gene ID: CT271

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (acidic)

Gene Start:
304018

Gene Stop:
303734

Gene Length:
285

Molecular Weight*:
11357

pI*:
4.95

Net Charge*:
-2.96

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CT271 is orthologously related to CPn0420, a Chlamydia-specific hypothetical protein. They share 66% similarity.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis, however residues 65-92 are 42% similar to a
stretch of CT737, which appears to be a eukaryotically
derived sequence.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
19
non-globular  
33  
95

PDB Hit:
none

Gene Protein Sequence:
MNRYRFSRLLVCLSLLCCALYRYIDKQNDLTKLRLEIPCLWAQLRQIEQE
NVALSFLLEKLESPEHLLQIAFLPEYQYLEYLSEEKISVLAYESP

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAGGTATCGGTTTTCGCGACTACTTGTCTGTTTAAGTCTTTTGTG
TTGCGCTCTTTATCGGTATATAGATAAACAGAATGATCTTACAAAACTTC
GTTTAGAAATCCCTTGTTTATGGGCTCAATTGCGTCAGATAGAACAAGAA
AATGTTGCGCTTAGTTTTTTACTAGAGAAATTAGAAAGCCCTGAACATTT
GTTGCAGATAGCTTTTCTTCCAGAATACCAGTATCTAGAGTATCTTAGCG
AAGAGAAAATCAGTGTTTTAGCTTATGAATCACCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy