Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR224 IGR221 IGR220 IGR222 IGR223 ihfA, - CT267 CT272 CT266 murE, - CT269 msbA, - CT264 penA,pbp, - CT270 ihfA, - CT267 CT272 CT266 murE, - CT269 msbA, - CT264 penA,pbp, - CT270 ihfA, - CT267 CT272 CT266 murE, - CT269 msbA, - CT264 penA,pbp, - CT270 CT271 amiA, - CT268 accA, - CT265 CT271 amiA, - CT268 accA, - CT265
* Calculated from Protein Sequence

Gene ID: CT268

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
amiA  

Definition:
probable N-acetylmuramoyl-l-alanine amidase

Gene Start:
300112

Gene Stop:
299336

Gene Length:
777

Molecular Weight*:
28676

pI*:
10.77

Net Charge*:
19.25

EC:
3.5.1.28  

Functional Class:
cell envelope; peptidoglycan  

Pathway: pathway table
Metabolism of Complex Carbohydrates; Peptideglycan biosynthesis

Comment:
AMIA and CWLB are responsible in E.coli and B.subtilis
for a hydrolysis reaction that links the cell wall component
N-acetylmuramoyl to L-amino acid residues in the glycoprotein.
See CT269, CT270, CT272, CT756, CT758, CT761, and CT762.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to bacterial cell wall hydrolysis
proteins associated with N-acetylmuramoyl-L-alanine amidase,
a major autolysin: for example, residues 49-239 are 32% similar to
CWLB_BACSU. Residues 51-249 are 26% similar to AMIA_ECOLI. CT268 is
similar to TP0247 of T.pallidum, a predicted amiA protein and similar to PG932 of P.gingivalis. No similarity
to M.genitalium.

CT268 is orthologously related to CPn0417, a predicted N-acetylmuramoyl-l-alanine amidase: residues 8-239 are 59% similar to CPn0417.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0860
COG name: N-acetylmuramoyl-L-alanine amidase
Functional Class:  M
The phylogenetic pattern of COG0860 is -----q-CEBRhuj--olin-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 61-122 are 41% similar to an N-acetylmuramoyl-L-alanine
amidase domain as seen in AMIB_HAEIN.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis, however CT268
residues 215-246 are 50% similar to a domain of CT003, which is
thought to be an amidase.

Pfam Summary:  Pfam Search
Residues 121 to 240 (E-value = 5.5e-55) place CT268 in the Amidase_3 family which is described as N-acetylmuramoyl-L-alanine amidase (PF01520)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
27  
47

PDB Hit:
none

Gene Protein Sequence:
MRGIRSSNIRRLSLMIERLCVKPWQPFVNLTLLLLLLTLSSPVSCFADAA
GIPKVSRNELIVIDPGHGGKDEGTADKELRYKEKTLALSIALSVQGCLRR
MGYKTIMTRATDVYVDLSKRAAIANQNKADVFVSIHCNHSSNTSALGTEI
YFYNDKNILRTRKSESLGKSILAFMQKNGALRERKVKEGNFAVIRETTMP
AVLVETGFLSNSKERAALLDARYRSHLAKGIAEGIHAFILNRQVDKTVSV
SSGAKKVHK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGGGGTATCAGATCTTCAAACATCAGACGATTGTCTTTGATGATCGA
GAGGTTGTGTGTGAAGCCTTGGCAGCCCTTTGTTAATTTGACATTATTGC
TGTTGCTGCTTACTTTAAGTAGTCCAGTTAGTTGTTTTGCTGATGCTGCG
GGGATTCCTAAGGTAAGTAGGAATGAACTTATAGTCATAGATCCTGGTCA
TGGCGGTAAAGACGAGGGAACTGCAGATAAGGAATTACGGTACAAAGAGA
AAACTTTGGCGTTGTCGATAGCTTTAAGCGTGCAAGGATGTTTGCGTCGC
ATGGGGTATAAGACGATAATGACAAGGGCTACGGATGTATATGTCGATCT
AAGTAAGCGAGCTGCAATAGCAAATCAGAATAAGGCTGATGTTTTTGTTA
GTATCCACTGTAATCACTCGTCTAATACATCTGCTTTAGGAACTGAGATT
TATTTTTATAATGATAAAAACATATTAAGGACTAGAAAATCAGAGAGCTT
AGGTAAGTCGATCTTGGCTTTTATGCAAAAAAATGGAGCTTTACGCGAAC
GTAAAGTGAAAGAAGGTAATTTCGCGGTAATTCGAGAAACAACCATGCCT
GCGGTCCTTGTGGAAACAGGGTTTCTTTCCAATTCTAAAGAGCGAGCCGC
TCTTTTAGATGCTCGTTATCGCTCGCACTTAGCCAAAGGTATTGCAGAAG
GCATACATGCTTTTATTTTGAATCGACAAGTTGACAAGACTGTATCAGTA
AGCTCAGGAGCAAAAAAAGTGCATAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy