Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR218 IGR219 IGR221 IGR220 IGR222 IGR217 IGR223 ihfA, - CT267 CT266 murE, - CT269 msbA, - CT264 penA,pbp, - CT270 CT260 dnaQ, - CT261 CT262 ihfA, - CT267 CT266 murE, - CT269 msbA, - CT264 penA,pbp, - CT270 CT260 dnaQ, - CT261 CT262 ihfA, - CT267 CT266 murE, - CT269 msbA, - CT264 penA,pbp, - CT270 amiA, - CT268 accA, - CT265 amiA, - CT268 accA, - CT265 CT260 dnaQ, - CT261 CT262 CT263 CT263
* Calculated from Protein Sequence

Gene ID: CT265

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
accA  

Definition:
acetyl-CoA carboxylase transferase (alpha subunit)

Gene Start:
297379

Gene Stop:
296408

Gene Length:
972

Molecular Weight*:
36343

pI*:
6.21

Net Charge*:
-3.61

EC:
6.4.1.2  

Functional Class:
energy metabolism; pyruvate metabolism  
fatty acid and phospholipid metabolism  

Pathway: pathway table
Carbohydrate Metabolism; Pyruvate metabolism
Lipid Metabolism; Fatty acid biosynthesis

Comment:
See CT293 for the beta subunit. See also CT123 and CT124.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to carboxyltransferase alpha
subunits, e.g., residues 3-319 are 46% similar to the
Synechocystis enzyme; residues 4-312 are 48% similar to the
B. subtili enzyme. No similarities to T.pallidum or M.genitalium.

CT265 is orthologous to CPn0414: residues 1-324 are 86% similar to CPn0414.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0825
COG name: Acetyl-CoA carboxylase alpha subunit
Functional Class:  I
The phylogenetic pattern of COG0825 is a--kyqvceBRhuj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 133-206 are 66% similar to a carboxylase beta ligase domain
of ACCA_HAEIN. Residues 7-129, 208-265, and 266-312 also correspond
to defined carboxylase domains found in ACCA_ECOLI and ACCA_ANTSP.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
Residues 2 to 146 (E-value = 1.2e-93) place CT265 in the ACCA family which is described as Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit (PF03255)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
48
transmembrane  
180  
214

PDB Hit:
none

Gene Protein Sequence:
MELLPHEKQVVEYEKTIAEFKEKNKENSLLSSSEIQKLDKRLDRLKEKIY
SDLTPWERVQICRHPSRPRTVNYIEGMCEEFVELCGDRTFRDDPAVVGGF
AKIQGQRFMLIGQEKGCDTKSRMHRNFGMLCPEGFRKALRLAKMAEKFGL
PIIFLVDTPGAFPGLTAEERGQGWAIATNLFELARLATPIIVIVIGEGCS
GGALGMAIGDVVAMLEHSYYSVISPEGCASILWKDPKKNSDAAAMLKMHG
EDLKGFAIVDAVIKEPIGGAHHNPAATYRSVQEYVLQEWLKLKDLPVEEL
LEKRYQKFRTIGLYETSSESDSEA

Gene Nucleotide Sequence:  Sequence Viewer
GTGGAACTACTTCCTCATGAAAAACAGGTTGTCGAATACGAAAAAACGAT
CGCCGAGTTTAAAGAAAAAAATAAAGAAAACAGCCTGCTTTCTTCTTCAG
AGATTCAAAAATTGGATAAGCGTTTAGATAGATTAAAAGAAAAAATTTAT
TCCGATCTCACCCCTTGGGAAAGAGTACAAATTTGTCGACATCCTTCGAG
ACCTAGAACAGTGAATTATATCGAAGGAATGTGCGAAGAGTTTGTAGAAC
TTTGTGGAGATCGAACGTTCCGAGATGATCCTGCAGTTGTCGGAGGGTTC
GCAAAGATTCAAGGGCAGCGTTTCATGCTTATAGGGCAAGAAAAGGGTTG
CGACACAAAATCTCGCATGCATCGTAACTTCGGGATGCTTTGTCCCGAAG
GCTTTAGAAAGGCTCTACGCTTAGCTAAAATGGCAGAGAAATTCGGTTTG
CCAATTATCTTTCTCGTTGATACCCCTGGAGCTTTCCCTGGATTAACAGC
CGAAGAAAGAGGTCAAGGTTGGGCTATTGCGACAAACTTATTTGAGTTAG
CTAGATTAGCTACCCCAATCATTGTAATTGTGATTGGTGAAGGATGTTCA
GGAGGCGCTCTAGGAATGGCTATAGGAGATGTTGTAGCGATGCTAGAACA
CTCGTATTATTCTGTAATTTCTCCTGAAGGGTGTGCTTCTATTTTATGGA
AAGATCCTAAAAAGAACAGCGATGCTGCTGCCATGTTAAAAATGCATGGA
GAGGATCTTAAGGGATTTGCTATTGTGGACGCAGTGATCAAAGAACCCAT
AGGTGGGGCTCATCACAATCCTGCGGCCACATATCGTAGTGTTCAAGAAT
ATGTCCTTCAAGAATGGCTTAAATTGAAAGATTTACCGGTAGAAGAGTTG
CTAGAAAAACGATATCAGAAATTCCGAACGATAGGTCTATATGAAACTTC
TTCTGAAAGCGATTCTGAGGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy