Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR216 IGR215 IGR218 IGR219 IGR220 IGR217 CT259 yfhO,nifS, - CT258 CT266 msbA, - CT264 CT260 dnaQ, - CT261 CT262 tlyC_1, - CT256 CT259 yfhO,nifS, - CT258 CT266 msbA, - CT264 CT260 dnaQ, - CT261 CT262 tlyC_1, - CT256 CT259 yfhO,nifS, - CT258 msbA, - CT264 accA, - CT265 accA, - CT265 CT266 CT260 dnaQ, - CT261 CT262 tlyC_1, - CT256 CT263 CT257 CT263 CT257
* Calculated from Protein Sequence

Gene ID: CT261

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaQ  

Definition:
DNA polymerase III alpha/epsilon chain

Gene Start:
292430

Gene Stop:
293125

Gene Length:
696

Molecular Weight*:
26512

pI*:
5.70

Net Charge*:
-4.69

EC:
2.7.7.7  

Functional Class:
DNA replication and repair  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
In addition to its replicative activities, the pol III enzyme may have
3' to 5' exonuclease activity. The alpha chain has the polymerizing activity,
while the epsilon chain has the exonucleolytic activity. From their lengths,
it would seem that both CT261 and CT536 may be alpha chains. On the other hand, when
A.aeolicus putative epsilon is blasted against ctpro_all, CT261 has a score
of 82 when CT536 has a score of 71, thus CT261 is the best candidate at the
moment for the epsilon chain. See CT187 for the gamma/tau chain sequences and CT075
for the beta chain.

Both CT261 and CT405 are similar to residues 411-618 approximately of MG031, thus not nearly so
long; these are most similar to polIII alpha sequences from gram-positive bacteria (see
Koonin and Bork, TIBS21:128, 1996). The CT alpha or alpha/epsilon, then, may not embody an exonucleolytic domain,
which in MG031 is found in the N-terminus.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to DNA polymerase III sequences, e.g., residues
5-166 are 31% similar to the epsilon subunit enzymes from a.aeolicus (AE000714).
Residues 5-177 are 30% similar to the alpha subunit DP3A_BACSU. CT261
is similar to TP0643 of T.pallidum and to MG031, polIII sequences: residues
5-188 are similar to residues 417-610 of MG031. Similar to PG1614 of P.gingivalis.


CT261 is orthologously related to CPn0410, a
predicted DNA polymerae III alpha/epsilon chain:
residues 1-230 are 66% similar to CPn0410.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0847
COG name: DNA polymerase III epsilon subunit (3'-5' exonuclease)
Functional Class:  L
The phylogenetic pattern of COG0847 is a---YQvcEbRHuj---lINx
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 5-56 are 53% similar to a protein operon TLPA domain represented
in CP81_BP186, a hypothetical 21.5 kDa protein in bacteriophage 186. The
only other representative of this domain is YTL1_SALTY, located near the
TLPA operon. Residues 29-78 are 42% similar to a helicase domain found in
Y002_MYCTU.

Paralogs:  Local Blast Search
CT261 is paralogously related to CT536, also a pol subunit sequence:
residues 8-223 are 33% similar to CT536.

Pfam Summary:  Pfam Search
Residues 4 to 159 (E-value = 8.9e-55) place CT261 in the Exonuc_X-T family which is described as Exonuclease (PF00929)

PDB Hit:
none

Gene Protein Sequence:
MPALIFYDTETTGTQIDKDRIVELAAYNGTTSESFQTLVNPEIPIPAEAT
KIHGITTAEVADAPRFPEAYQKFIEFCGTDNILVAHNNNAFDYPLLVREC
RRHGLSEPQLRTIDSLKWAKKYRTDLPQHSLQYLRQVYGFEENQAHRALD
DVITLYRVFSALVGDLSPDQIYDLLNETCHPRIFKMPFGKYKGKPLSEVP
SSYIAWLQKGDYLLQPENKEIKAAIEAYQQLK

Gene Nucleotide Sequence:  Sequence Viewer
GTGCCAGCTTTAATTTTTTATGATACAGAAACGACAGGTACGCAGATAGA
TAAGGATCGTATAGTGGAGCTAGCTGCTTACAACGGGACTACGAGCGAGT
CTTTCCAAACGCTAGTAAACCCTGAAATCCCTATACCTGCTGAGGCAACT
AAAATTCATGGTATTACGACTGCGGAAGTAGCCGACGCCCCCAGATTCCC
AGAAGCTTATCAGAAATTTATCGAATTTTGTGGTACAGATAATATTCTTG
TAGCTCACAATAACAATGCTTTCGATTATCCTCTGTTAGTTCGTGAATGT
CGTAGACACGGCTTATCTGAGCCTCAGCTTCGTACTATAGATTCGTTAAA
ATGGGCAAAAAAATATCGAACCGACTTGCCTCAGCATAGTCTCCAATACC
TTCGTCAGGTATACGGATTCGAAGAAAATCAAGCGCACCGAGCATTAGAT
GACGTAATCACTCTTTATAGAGTATTTTCAGCTTTAGTGGGGGATTTGTC
TCCTGATCAAATTTATGATCTACTAAATGAGACTTGTCATCCTCGCATAT
TTAAAATGCCTTTCGGTAAGTATAAAGGGAAACCTCTTTCTGAAGTCCCC
TCTAGTTACATCGCCTGGTTACAAAAAGGTGATTACTTGCTACAACCAGA
AAATAAAGAAATTAAAGCAGCCATTGAGGCCTATCAGCAATTGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy