Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR203 IGR205 IGR202 IGR206 IGR208 IGR201 IGR207 IGR204 CT244 dnaA, - CT250 glgP, - CT248 CT249 CT242 pdhA,odpA, - CT245 firA,lpxD, - CT243 pdhC,aceF, - CT247 CT241 CT244 dnaA, - CT250 glgP, - CT248 CT249 CT242 pdhA,odpA, - CT245 firA,lpxD, - CT243 pdhC,aceF, - CT247 CT241 CT244 dnaA, - CT250 glgP, - CT248 CT249 pdhA,odpA, - CT245 firA,lpxD, - CT243 pdhC,aceF, - CT247 CT241 odpB,pdhB, - CT246 odpB,pdhB, - CT246 CT242
* Calculated from Protein Sequence

Gene ID: CT246

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
odpB  pdhB  

Definition:
pyruvate dehydrogenase E1 beta subunit

Gene Start:
274578

Gene Stop:
275561

Gene Length:
984

Molecular Weight*:
36185

pI*:
5.73

Net Charge*:
-5.58

EC:
1.2.4.1  

Functional Class:
energy metabolism; glycolysis and gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Glycolysis / Gluconeogenesis
Carbohydrate Metabolism; Pyruvate metabolism

Comment:
In B. subtilis, this enzyme is responsible for the conversion of alpha-keto
acids to acyl-CoA and CO2. The E1 component, made up of an alpha (CT245) and beta chain,
is an alpha keto-acid decarboxylase. See CT245, CT247, CT340, CT331, CT557, CT054, CT055. CT246
is similar to the C-terminal portion of CT340 and both over this region
are similar to the lipoamide protein of the African clawed frog.

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to typically eukaryotic pyruvate dehydrogenase E1 beta
subunit sequences, e.g., residues 2-327 of CT246 are approximately 48%
similar to the enzyme from the African clawed frog (U39669). Other strong
similarities involve the human and rat ODPA sequences. Best hit to a bacterial
sequence was to ODBB_BACSU: residues 7-326 are 41% similar to this protein.
CT246 is similar to MG273 of M.genitalium. No similarity to T.pallidum.

CT246 is orthologously related to CPn0305:
residues 1-328 are 81% similar to that of CPn0305.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0022
COG name: Thiamine pyrophosphate-dependent dehydrogenases, E1 component beta subunit
Functional Class:  C
The phylogenetic pattern of COG0022 is ----y--c-Br---gp--INx
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 7-140 are 58% similar to a well-defined beta dehydrogenase E1
domain as represented by ODPB_PEA. Residues 7-52, 143-222, and 239-283
match domains found in ODPB_PORPU, ODBB_PSEPU, and ACOB_ALCEU.

Paralogs:  Local Blast Search
CT246, like CT245, is paralogously related to CT340, said to be a
2-oxoisovalerate dehydrogenase beta subunit: residues 9-319 are about
41% similar to CT340. A weaker relationship is seen to CT331, a putative
transketolase B sequence: residues 53-283 are 21% similar to this protein.

Pfam Summary:  Pfam Search
Residues 7 to 183 (E-value = 2.5e-72) place CT246 in the Transket_pyr family which is described as Transketolase, pyridine binding domain (PF02779)
Residues 196 to 319 (E-value = 3.5e-55) place CT246 in the Transketolase_C family which is described as Transketolase, C-terminal domain (PF02780)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
66  
100
transmembrane  
138  
154

PDB Hit:
none

Gene Protein Sequence:
MPNFVTLEIREAIRQAIDEEMTRDPNVCILGEEVAEYNGAYKVTKNLLDK
WGPTRVIDTPISEAAFSGIGIGAALTGLRPIIEFMSWNFSLVAADQIISH
AAKMYYMTGGKFAVPIVFRGANGAAAQVSCQHSHCIEALYANIPGLIVIA
PSTPADAKGLLKSAIRDNNPVLFLENELDYNLKGEVPSEEYLIPIGKARI
VQEGKDLTIISHSRMVSIVEQAAKTAKQRWGLSIETIDLRTIKPLDVATL
LTSVKKTGNCLVVEEGHYFCGISSEVITTITEHIFDYLDHPPLRVCQKET
PMPYNKTLEMATLPNINRILDAIEKIMR

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTAATTTTGTTACACTCGAAATCCGAGAGGCTATTAGACAAGCTAT
TGATGAAGAAATGACCAGAGATCCTAACGTCTGTATCCTAGGAGAGGAGG
TCGCTGAATATAATGGTGCTTATAAAGTTACTAAAAACCTCTTAGATAAA
TGGGGACCCACTCGAGTTATTGATACACCCATTAGCGAAGCTGCTTTCTC
TGGAATTGGAATCGGAGCAGCGCTAACTGGACTTCGCCCAATTATTGAAT
TTATGAGCTGGAACTTCTCTCTAGTTGCTGCTGATCAAATCATTTCTCAT
GCAGCAAAAATGTATTATATGACTGGAGGGAAATTTGCTGTTCCTATCGT
TTTTAGAGGCGCTAATGGAGCTGCTGCGCAAGTCTCTTGCCAACATTCTC
ATTGTATTGAAGCTCTTTATGCCAATATTCCTGGCTTAATTGTCATTGCT
CCATCAACTCCAGCCGATGCAAAGGGACTTCTTAAATCTGCTATTCGGGA
TAACAACCCCGTTCTATTCTTAGAAAATGAATTAGACTACAATCTTAAGG
GAGAGGTCCCTTCAGAAGAATACCTGATCCCCATTGGGAAAGCTCGTATC
GTTCAAGAAGGAAAAGATTTAACAATCATTTCGCATAGCCGCATGGTTTC
TATCGTTGAGCAAGCTGCTAAAACAGCAAAACAACGATGGGGACTCTCTA
TTGAAACCATTGACTTACGAACGATCAAACCTTTGGATGTTGCCACTCTC
CTCACTTCTGTCAAAAAAACAGGGAATTGTCTTGTCGTTGAAGAAGGGCA
TTATTTTTGTGGTATATCTTCGGAAGTGATTACGACGATTACAGAACATA
TTTTTGACTACCTAGATCATCCTCCTCTACGAGTCTGTCAAAAAGAAACG
CCTATGCCATATAATAAAACTCTAGAGATGGCGACTCTCCCAAATATTAA
CCGCATCCTGGATGCCATTGAAAAAATTATGAGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy