Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR203 IGR205 IGR202 IGR206 IGR201 IGR204 CT244 glgP, - CT248 CT242 pdhA,odpA, - CT245 firA,lpxD, - CT243 pdhC,aceF, - CT247 CT241 CT244 glgP, - CT248 CT242 pdhA,odpA, - CT245 firA,lpxD, - CT243 pdhC,aceF, - CT247 CT241 CT244 glgP, - CT248 CT242 pdhA,odpA, - CT245 firA,lpxD, - CT243 pdhC,aceF, - CT247 CT241 odpB,pdhB, - CT246 odpB,pdhB, - CT246
* Calculated from Protein Sequence

Gene ID: CT245

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pdhA  odpA  

Definition:
pyruvate dehydrogenase E1 alpha subunit

Gene Start:
273563

Gene Stop:
274582

Gene Length:
1020

Molecular Weight*:
37207

pI*:
5.94

Net Charge*:
-7.47

EC:
1.2.4.1  

Functional Class:
energy metabolism; glycolysis and gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Glycolysis / Gluconeogenesis
Carbohydrate Metabolism; Pyruvate metabolism

Comment:
This enzyme is responsible for the conversion of alpha keto-amino acids to
acyl-CoA and CO2. The E1 component, made up of an alpha and beta (CT246) chain,
is an alpha-keto-acid decarboxylase. See CT246, CT247, CT557, CT340, CT054, and CT055. CT245 is curiously
similar to eukaryotic enzyme sequences.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to pyruvate dehdrogenase E1 alpha sequences,
e.g., residues 25-340 are approximately 32% similar to
ODPA_MOUSE (see ProDom analysis). The highest hits throughout are to
eukaryotic enzyme sequences. Residues 3-339 are 32% similar to
ODPA_ARATH. CT245 is similar to MG274 of M.genitalium, however no similarity
found to T.pallidum.

CT245 is orthologously related to CPn0304:
residues 7-340 are 72% similar to residues
8-342 of CPn0304.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1071
COG name: Thiamine pyrophosphate-dependent dehydrogenases, E1 component alpha subunit
Functional Class:  C
The phylogenetic pattern of COG1071 is ----y--c-BR---gp--INx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Significant match to block BL00801C, which encompasses
transketolase proteins, e.g., residues 156-195 of CT245
are significant similar to a block from TKT_MOUSE.

ProDom Summary:  Protein Domain Search
Residues 173-304 are approximately 34% similar to a dehydrogenase
alpha E1 domain represented by ODPA_PORPU. Residues 37-133
and 137-171 are also well-defined in their relationships
to ODPA_PORPU and ODPT_MOUSE.

Paralogs:  Local Blast Search
CT245 appears to be paralogously related to CT340, thought to be a
2-oxoisovalerate dehydrogenase beta subunit: residues 58-344 of CT245 are
29% similar to CT340. A weaker similarity is seen to CT054, an alpha ketoglutarate
dehydrogenase: residues 145-308 are 26% similar to this predicted
protein.

Pfam Summary:  Pfam Search
Residues 35 to 332 (E-value = 5.8e-72) place CT245 in the E1_dh family which is described as Dehydrogenase E1 component (PF00676)

PDB Hit:
none

Gene Protein Sequence:
MHPLTLNIASEETTEARVFHVIENFGNSFCIDLLKKMLLIREFEIRGEEA
YLEGLVGGFYHSYIGQEAVATAAIACTGKDHWFFSSYRCHGVALLLDIPL
RQLAAELLGKETGCALGRGGSMHMCGDRLPGGFGIVGGQIPLAAGAAFSM
KYQNSSSISMCFIGDGAVAQGVFHETLNFVALHSLPLMLIIENNGWSMGT
ALHRAIAKQPIAESQAISYGLSSITLNGFDLFNSLIGFREAYHHMQQTGS
PIIVEALCSRFRGHSISDPNLYRSKEEMQCLLKRDPILFAKEWLIRANVL
SEDDFKDLRQTSKTAVLEAVAQARLDPEPAVATLEEGVYA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATCCTCTGACTCTCAACATAGCTTCTGAGGAAACTACAGAAGCCCG
AGTTTTTCATGTTATTGAAAACTTCGGAAATTCTTTCTGCATTGACCTTT
TGAAAAAAATGCTACTCATTCGCGAATTTGAGATTCGCGGAGAAGAGGCC
TATTTAGAAGGCCTTGTTGGAGGATTTTATCACTCTTATATCGGTCAAGA
AGCTGTTGCTACAGCAGCTATTGCTTGCACAGGGAAAGACCACTGGTTTT
TTTCCTCTTATCGTTGTCACGGAGTAGCTCTGCTGCTGGATATCCCTTTA
CGACAACTGGCAGCAGAACTTCTAGGGAAAGAAACAGGGTGTGCTTTAGG
ACGAGGCGGATCTATGCATATGTGTGGTGATCGTCTTCCTGGAGGTTTTG
GTATCGTTGGTGGACAAATTCCTCTGGCTGCAGGTGCAGCATTTTCTATG
AAGTACCAAAACTCATCTTCTATATCTATGTGTTTTATTGGAGATGGAGC
TGTAGCTCAAGGAGTCTTTCATGAAACATTAAATTTTGTAGCGCTTCACT
CCCTTCCCTTAATGCTCATTATTGAAAACAATGGATGGAGTATGGGAACA
GCCTTACATAGAGCCATTGCTAAACAGCCTATAGCAGAATCCCAAGCGAT
TTCTTATGGTCTTTCTTCGATCACTTTGAATGGATTCGATTTATTTAATT
CGCTTATAGGATTTAGAGAAGCTTATCACCACATGCAACAAACAGGTTCT
CCTATTATCGTAGAGGCGCTATGTTCTCGATTTAGAGGACACTCTATTTC
CGATCCTAATTTATATCGCTCTAAAGAGGAAATGCAATGTCTTCTCAAAA
GAGATCCTATCCTTTTTGCAAAAGAATGGCTCATTCGTGCGAATGTCCTA
TCCGAAGATGATTTTAAAGATTTGCGTCAAACAAGCAAAACAGCTGTCCT
AGAAGCAGTCGCTCAAGCTCGTCTTGATCCAGAACCAGCTGTAGCTACTT
TAGAAGAGGGGGTCTATGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy