Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR203 IGR205 IGR202 IGR201 IGR199 IGR204 IGR200 fabH, - CT239 CT244 CT242 recR, - CT240 pdhA,odpA, - CT245 firA,lpxD, - CT243 pdhC,aceF, - CT247 CT241 fabH, - CT239 CT244 CT242 recR, - CT240 pdhA,odpA, - CT245 firA,lpxD, - CT243 pdhC,aceF, - CT247 CT241 fabH, - CT239 CT244 CT242 recR, - CT240 pdhA,odpA, - CT245 firA,lpxD, - CT243 pdhC,aceF, - CT247 CT241 odpB,pdhB, - CT246 odpB,pdhB, - CT246
* Calculated from Protein Sequence

Gene ID: CT243

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
firA  lpxD  

Definition:
UDP-3-O-(R-3-hydoxymyristoyl)-glucosamine-N-acyltransferase

Gene Start:
271084

Gene Stop:
272145

Gene Length:
1062

Molecular Weight*:
38391

pI*:
7.50

Net Charge*:
3.78

EC:
2.3.1.-  

Functional Class:
cell envelope; surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Amino Acid Metabolism; Lysine biosynthesis
Metabolism of Complex Lipids; Glycerolipid metabolism
Nucleotide Metabolism; Aminosugars metabolism

Comment:
The LPXD enzyme in E. coli catalyzes the third step in
lipid A (endotoxin) biosynthesis; it is reported to be
a rifampicin resistance protein in E.coli and S.typhimurium.
See CT531, CT411, CT533 which probably catalyze earlier steps in lipid A
biosynthesis.

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to UDP-3-O-(R-hydroxymyristoyl) glucosamine N-acyltransferase sequences,
e.g. residues 8-346 are 34% similar to LPXD_ECOLI. No similarities to T.pallidum or M.genitalium. Also similar to PG61 of P.gingivalis.

CT243 is orthologous to CPn0302: residues 6-351 of CT243 are 71% similar to residues 7-352 of CPn0302, a predicted UDP glucosamine N-acyltransferase from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1044
COG name: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
Functional Class:  M
The phylogenetic pattern of COG1044 is -----q-ce--huj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 137-299 span ten blocks which encompass hexapeptide repeat containing
transferase, BL00101A and BL00101B. Of these, residues
137-143 are concerned with A and the remaining nine matches are concerned with
B. See TABB_PSESZ and THGA_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 8-98 and 155-314 are similar to lipid protein transferase A and acyltransferase
domains as observed in LPXD_RICRI and LPXD_ECOLI.

Paralogs:  Local Blast Search
CT243 is paralogous to CT531, a predicted acyl-carrier UDP-GlcNAc O-acyltransferase.

Pfam Summary:  Pfam Search
Residues 6 to 109 (E-value = 8.9e-44) place CT243 in the LpxD family which is described as UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD (PF04613)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
102  
314
coil-coil  
317  
354

PDB Hit:
gi|1311000|pdb|1LXA| Udp N-Acetylglucosamine Acyltransferase Transferase, Acyltransferase, Lipid A Biosynthesis, Lipid Synthesis Mol_id: 1; Molecule: Udp N-Acetylglucosamine O-Acyltransferase; Chain: Null; Synonym: Lpxa; Ec: 2.3.1.129; Engineered: Yes; M

Gene Protein Sequence:
MSQSTYSLEQLADFLKVEFQGNGATLLSGVEEIEEAKTAHITFLDNEKYA
KHLKSSEAGAIIISRTQFQKYRDLNKNFLITSESPSLVFQKCLELFITPV
DSGFPGIHPTAVIHPTAIIEDHVCIEPYAVVCQHAHVGSACHIGSGSVIG
AYSTVGEHSYIHPRVVIRERVSIGKRVIIQPGAVIGSCGFGYVTSAFGQH
KHLKHLGKVIIEDDVEIGANTTIDRGRFKHSVVREGSKIDNLVQIAHQVE
VGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVT
KSITSPGIYGGAPARPYQEIHRQVAKVRNLPRLEERIAALEKLVQKLEAL
SEQH

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTCAATCCACTTATTCTCTTGAACAATTAGCTGATTTTTTGAAAGT
CGAGTTTCAAGGAAATGGAGCTACTCTTCTTTCCGGAGTTGAAGAGATCG
AGGAAGCAAAAACGGCACACATCACATTCTTAGATAATGAAAAGTATGCT
AAACATTTAAAATCATCGGAAGCTGGCGCTATCATCATATCTCGAACACA
GTTTCAAAAATATCGAGACTTGAATAAAAACTTTCTTATCACTTCTGAGT
CTCCTTCCCTAGTTTTTCAAAAGTGTTTAGAATTATTCATTACTCCTGTT
GACTCAGGATTCCCAGGTATTCATCCGACAGCCGTTATCCATCCAACTGC
GATTATTGAAGATCATGTTTGTATTGAGCCCTATGCTGTAGTTTGTCAGC
ATGCTCATGTTGGATCTGCTTGCCATATTGGGTCAGGTAGCGTCATTGGA
GCTTATTCAACCGTTGGAGAACACTCTTATATCCATCCTCGAGTAGTTAT
TAGAGAACGAGTCTCTATTGGGAAACGAGTAATTATTCAACCAGGAGCTG
TTATAGGCTCTTGTGGGTTCGGGTATGTTACTAGTGCTTTTGGACAGCAC
AAACATTTAAAACACCTCGGGAAAGTCATTATTGAAGACGACGTAGAGAT
CGGCGCAAATACAACTATCGACAGAGGCCGGTTTAAACACAGTGTTGTGC
GTGAAGGTTCGAAAATTGATAATCTTGTGCAAATTGCCCATCAGGTGGAG
GTCGGTCAACACAGCATGATTGTAGCTCAAGCTGGAATTGCAGGTTCTAC
AAAGATTGGCAATCATGTAATTATCGGTGGACAAGCCGGCATAACCGGAC
ATATTTGCATTGCAGATCATGTCATTATGATGGCTCAGACTGGCGTCACT
AAATCTATTACTTCTCCAGGGATCTATGGCGGAGCGCCTGCTCGTCCATA
TCAAGAAATTCATCGCCAAGTAGCCAAAGTACGCAACCTTCCACGACTCG
AAGAACGTATCGCAGCACTTGAGAAACTAGTCCAGAAATTAGAAGCTCTC
TCAGAACAACAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy