Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR203 IGR205 IGR198 IGR202 IGR201 IGR199 IGR204 IGR200 fabD,tfpA, - CT238 fabH, - CT239 CT244 CT242 recR, - CT240 pdhA,odpA, - CT245 firA,lpxD, - CT243 pdhC,aceF, - CT247 CT241 fabD,tfpA, - CT238 fabH, - CT239 CT244 CT242 recR, - CT240 pdhA,odpA, - CT245 firA,lpxD, - CT243 pdhC,aceF, - CT247 CT241 fabD,tfpA, - CT238 fabH, - CT239 CT244 CT242 recR, - CT240 pdhA,odpA, - CT245 firA,lpxD, - CT243 CT241 odpB,pdhB, - CT246 odpB,pdhB, - CT246 pdhC,aceF, - CT247
* Calculated from Protein Sequence

Gene ID: CT242

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
probable outer membrane protein

Gene Start:
270535

Gene Stop:
271053

Gene Length:
519

Molecular Weight*:
19430

pI*:
4.63

Net Charge*:
-7.04

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST. A sub-threshold (E-value 0.003)
match to ompH of Yersinia: residues 24-164 are approximately
24% similar to the Yersinia protein. No similarities to T.pallidum or
M.genitalium.

CT242 is orthologously related to CPn0301, a predicted OmpH-like outer membrane protein: residues 1-171 are 56% similar to CPn0301.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0419
COG name: ATPase involved in DNA repair
Functional Class:  L
The phylogenetic pattern of COG0419 is amtkyqvceb------ol---
Number of proteins in this genome belonging to this COG is 3


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 24-164 of CT242 are about 27% similar to a domain
represented by OMPH_YERPS (see BLAST summary).

Paralogs:  Local Blast Search
Other than the weak similarity seen to CT017, no evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 1 to 167 (E-value = 1.3e-68) place CT242 in the OmpH family which is described as Outer membrane protein (OmpH-like) (PF03938)

Structural Feature(s):
Feature Type  Start  Stop
gram positive/gram negative signal  
1  
20
coil-coil  
36  
137

PDB Hit:
none

Gene Protein Sequence:
MKKFLLLSLMSLSSLPTFAANSTGTIGIVNLRRCLEESALGKKESAEFEK
MKNQFSNSMGKMEEELSSIYSKLQDDDYMEGLSETAAAELRKKFEDLSAE
YNTAQGQYYQILNQSNLKRMQKIMEEVKKASETVRIQEGLSVLLNEDIVL
SIDSSADKTDAVIKVLDDSFQNN

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAGTTCTTATTACTTAGCTTAATGTCTTTGTCATCTCTACCTAC
ATTTGCAGCTAATTCTACAGGCACAATTGGAATCGTTAATTTACGTCGCT
GCCTAGAAGAGTCTGCTCTTGGGAAAAAAGAATCTGCTGAATTCGAAAAG
ATGAAAAACCAATTCTCTAACAGCATGGGGAAGATGGAGGAAGAACTGTC
TTCTATCTATTCCAAGCTCCAAGACGACGATTACATGGAAGGTCTATCCG
AGACCGCAGCTGCCGAATTAAGAAAAAAATTCGAAGATCTATCTGCAGAA
TACAACACAGCTCAAGGGCAGTATTACCAAATATTAAACCAAAGTAATCT
CAAGCGCATGCAAAAGATTATGGAAGAAGTGAAAAAAGCTTCTGAAACTG
TGCGTATTCAAGAAGGCTTGTCAGTCCTTCTTAACGAAGATATTGTCTTA
TCTATCGATAGTTCGGCAGATAAAACCGATGCTGTTATTAAAGTTCTTGA
TGATTCTTTTCAAAATAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy