Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR203 IGR198 IGR202 IGR201 IGR199 IGR204 IGR197 IGR200 fabG, - CT237 fabD,tfpA, - CT238 fabH, - CT239 CT244 CT242 recR, - CT240 pdhA,odpA, - CT245 firA,lpxD, - CT243 CT241 fabG, - CT237 fabD,tfpA, - CT238 fabH, - CT239 CT244 CT242 recR, - CT240 pdhA,odpA, - CT245 firA,lpxD, - CT243 CT241 fabG, - CT237 fabD,tfpA, - CT238 fabH, - CT239 CT244 CT242 recR, - CT240 pdhA,odpA, - CT245 firA,lpxD, - CT243 CT241
* Calculated from Protein Sequence

Gene ID: CT241

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
probable outer membrane protein (Omp85 analog)

Gene Start:
268088

Gene Stop:
270463

Gene Length:
2376

Molecular Weight*:
88745

pI*:
9.87

Net Charge*:
17.00

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:
Possible OMP85 analog.

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to outer membrane proteins, e.g. residues
56-792 are 23% similar to an outer membrane protein in A.aeolicus (AE000733).
CT241 is 25% similar to an outer membrane protein encoded by T.pallidum,
TP0326. It is also similar to an outer memebrane protein in B.burgdorferi
(AE001178) and PG175 of P.gingivalis. No similarity to M.genitalium.

CT241 is orthologously related to CPn0300, a predicted outer membrane protein and they share 69% similarity.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0729
COG name: Predicted outer membrane protein
Functional Class:  M
The phylogenetic pattern of COG0729 is -----QvcE--Huj--olinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 34-284 and 361-688 are similar to antigenic signal precursor domains as observed
in D151_HAEIN.

Paralogs:  Local Blast Search
No paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 58 to 106 (E-value = 5.1e-08) place CT241 in the Surf_Ag_VNR family which is described as Surface antigen variable number repeat (PF07244)
Residues 128 to 187 (E-value = 6e-08) place CT241 in the Surf_Ag_VNR family which is described as Surface antigen variable number repeat (PF07244)
Residues 218 to 277 (E-value = 1.4e-08) place CT241 in the Surf_Ag_VNR family which is described as Surface antigen variable number repeat (PF07244)
Residues 299 to 358 (E-value = 2.1e-07) place CT241 in the Surf_Ag_VNR family which is described as Surface antigen variable number repeat (PF07244)
Residues 380 to 440 (E-value = 2.2e-07) place CT241 in the Surf_Ag_VNR family which is described as Surface antigen variable number repeat (PF07244)
Residues 443 to 792 (E-value = 6.6e-26) place CT241 in the Bac_surface_Ag family which is described as Surface antigen (PF01103)

Structural Feature(s):
Feature Type  Start  Stop
gram positive/gram negative signal  
1  
26
non-globular  
423  
501

PDB Hit:
none

Gene Protein Sequence:
MLGIRKKTILQLAVLLLLTFSRSSFCSTSEGRMVVESITITTQGENTQNK
RAIPKIKTKQGTLFSQADFDEDLRTLSKDFDRVEPIVEFRNGQAVISLIL
TAKPVIREINISGNEAIPTHKILKTLELYKNDLFDRELFFKNFDALRTLY
LKRGYYDSQLSYSHNHNEKEGFIDISIEIKEGRHGRIKKLTISGITRTEA
SDLGDIVLTKQYSTTTSWFTGAGVYHPDMVEQDLFAITNYFQNKGYADAK
VSKEVSTDAKGNITLLIVVDKGPLYTLGHVHIEGFTALSKRLLDKQLLVG
PNSLYCPDKIWTGAQKIRSAYARYGYVNTNVDVSFSAHPTLPVYDVTYRV
SEGSPYKIGLIKIKGNTHTKHDVILHETSLFPGDTFDRLKLEGTETRLRN
TGYFKSVSVYTVRSQLDPLDSNDLYRDVFIEVKETETGNLGLFLGFSSID
HLFGGAEIAESNFDLFGARNFLKKGFKSLRGGGEYLFLKANLGDKVTDYT
VKWTKPHFLNTPWILGVELDKSINKALSKDYSVDTYGGNISTTYILNDKL
KYGMYYRGSQTSLSLRKKTSSSNRPGPDLDSNKGFVSAAGLNVLYDSIDN
PRKPTMGIRSSLNFELSGLGGTYQFTKLTASGSIYRLLTKKGVLKVRAEA
KFIKPFGTTTAQGIPVSERFFLGGETTVRGYKPFIIGPKFSPTEPQGGLS
SLLLTEEFQYPLISQPCINAFVFLDSGFIGIEEYTIRLKDLCSSAGFGLR
FDMMNNVPIMLGWGWPFRPTEILNNEKIDVSQRFFFALGGVF

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTGGAATACGCAAAAAAACGATTCTGCAACTCGCTGTTTTACTGTT
GCTCACCTTTTCACGAAGTTCTTTCTGTTCAACTTCAGAAGGACGTATGG
TCGTAGAGTCTATCACCATTACGACTCAAGGAGAGAATACTCAAAATAAA
CGAGCTATTCCTAAAATAAAAACAAAGCAGGGGACGTTGTTCTCTCAAGC
AGATTTTGATGAAGATCTAAGAACACTTTCGAAAGATTTTGATCGAGTAG
AGCCTATCGTAGAGTTTCGTAATGGACAAGCTGTGATCTCTCTGATTCTG
ACGGCAAAACCTGTTATCAGAGAGATCAATATTTCAGGAAATGAAGCTAT
CCCCACTCATAAAATTCTGAAAACTTTAGAGCTTTATAAAAATGATCTTT
TTGATCGGGAATTATTCTTTAAAAATTTTGATGCGCTAAGAACTCTTTAT
TTGAAACGAGGGTACTACGATTCTCAACTCTCCTATTCTCATAATCATAA
TGAGAAAGAGGGCTTTATCGATATTTCCATCGAGATTAAAGAAGGACGTC
ACGGTCGCATAAAAAAATTAACGATTTCGGGAATTACGCGAACAGAAGCA
TCAGACTTAGGTGACATTGTTTTAACTAAACAATACTCCACAACAACGAG
CTGGTTCACTGGTGCCGGAGTGTATCATCCGGACATGGTAGAGCAAGACT
TATTTGCTATCACAAATTACTTCCAAAATAAAGGATATGCTGATGCTAAA
GTAAGCAAAGAGGTCTCTACAGATGCTAAAGGAAACATTACTTTGCTTAT
CGTTGTAGACAAAGGACCTTTATACACATTAGGTCACGTACATATAGAAG
GATTCACAGCGTTATCCAAAAGACTGCTCGATAAACAACTATTGGTTGGA
CCTAACTCCTTATATTGCCCAGATAAAATTTGGACTGGAGCACAAAAGAT
TCGTAGCGCATACGCTAGATATGGCTACGTGAACACTAACGTTGATGTCT
CCTTCTCAGCGCACCCCACTCTACCTGTTTACGATGTTACCTATCGAGTG
AGTGAAGGATCTCCCTACAAAATCGGGTTAATTAAAATCAAAGGGAACAC
TCATACTAAGCATGATGTGATTTTGCATGAGACTAGTCTTTTCCCTGGAG
ACACTTTTGATAGATTAAAACTGGAAGGTACAGAGACTCGTTTACGCAAC
ACCGGCTACTTTAAAAGTGTAAGTGTCTATACGGTTCGTTCCCAATTAGA
TCCTCTTGATTCTAACGACCTTTATCGAGATGTTTTTATTGAAGTCAAAG
AGACTGAAACAGGAAATCTTGGGCTATTCTTAGGATTCAGCTCCATTGAC
CATTTATTTGGAGGGGCAGAAATTGCAGAAAGCAACTTTGATTTATTTGG
AGCCCGAAACTTTCTCAAAAAAGGATTCAAATCTTTAAGAGGTGGTGGAG
AATACCTCTTCCTAAAAGCTAATTTAGGAGATAAGGTCACCGATTACACT
GTTAAATGGACGAAACCACACTTCTTAAATACCCCTTGGATTCTTGGAGT
AGAATTAGATAAATCAATTAATAAAGCTTTATCAAAAGACTACTCTGTGG
ATACCTATGGAGGGAATATCAGTACCACCTACATTCTTAACGATAAGTTA
AAATATGGGATGTATTACCGTGGTAGCCAAACAAGCTTAAGTTTGCGCAA
AAAAACGTCCAGCTCTAATAGACCTGGACCAGATTTAGATAGTAATAAAG
GATTTGTTTCCGCAGCGGGACTCAATGTTCTCTATGATTCTATTGATAAT
CCTAGAAAACCTACTATGGGAATCCGCAGCTCCTTAAACTTTGAATTATC
TGGTTTAGGCGGAACTTACCAATTTACTAAACTAACAGCTAGTGGTTCTA
TCTATCGCTTATTAACTAAAAAAGGTGTTTTGAAAGTCCGTGCAGAAGCT
AAGTTTATCAAACCTTTCGGAACAACAACTGCACAAGGCATTCCTGTCAG
CGAACGGTTCTTCTTAGGAGGTGAAACCACTGTTCGCGGTTACAAACCTT
TTATTATTGGACCGAAATTTTCTCCTACTGAACCACAAGGAGGCTTGTCT
TCCCTACTATTAACAGAAGAATTTCAATATCCTTTGATTTCTCAACCTTG
CATTAATGCCTTTGTATTTCTAGATTCCGGATTCATTGGGATAGAAGAGT
ACACTATTCGCCTGAAAGACCTTTGCAGTAGCGCCGGATTTGGTCTACGC
TTTGATATGATGAATAATGTGCCAATTATGCTAGGCTGGGGTTGGCCGTT
CCGCCCAACAGAAATCCTCAATAATGAAAAAATTGATGTATCTCAAAGAT
TCTTTTTTGCCTTGGGAGGAGTATTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy