Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR198 IGR202 IGR195 IGR196 IGR201 IGR199 IGR197 IGR200 acpP, - CT236 fabG, - CT237 fabD,tfpA, - CT238 fabH, - CT239 CT235 CT242 recR, - CT240 firA,lpxD, - CT243 CT241 CT234 acpP, - CT236 fabG, - CT237 fabD,tfpA, - CT238 fabH, - CT239 CT235 CT242 recR, - CT240 firA,lpxD, - CT243 CT241 CT234 acpP, - CT236 fabG, - CT237 fabD,tfpA, - CT238 fabH, - CT239 CT235 CT242 recR, - CT240 firA,lpxD, - CT243 CT241 CT234
* Calculated from Protein Sequence

Gene ID: CT239

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fabH  

Definition:
3-oxyacyl-[acyl-carrier protein] synthase (KAS III or FABH

Gene Start:
266973

Gene Stop:
265993

Gene Length:
981

Molecular Weight*:
35313

pI*:
7.35

Net Charge*:
1.32

EC:
2.3.1.41  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Lipid Metabolism; Fatty acid biosynthesis

Comment:
In E. coli, KAS III catalyzes an early condensation reaction in the fatty acid
biosynthesis pathway (acyl-ACP + malonyl-ACP -> 3-oxyacyl-ACP
+ CO2 + ACP).
CT236, CT237, CT238, and CT239 are all related to fatty acid biosynthesis and
may be involved in a single operon. See also CT770, CT104, and CT532.

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to oxoacyl carrier proteins, e.g. residues
1-325 are 43% similar to FABH_ECOLI.

CT239 is orthologous to CPn0298: residues 2-327 of CT239 are 74% similar to residues 10-335 of CPn0298, a predicted oxoacyl carrier protein synthase III from C. pneumoniae and similar to PG1872 of P.gingivalis.
No similarities to T.pallidum or M.genitalium.


COGS Summary:  COGS Search
BeTs to 12 clades of COG0332
COG name: 3-oxoacyl-[acyl-carrier-protein] synthase III
Functional Class:  I
The phylogenetic pattern of COG0332 is Amtkyq-ceBRhuj--o-inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 24-29 and 103-140 are matched to blocks BL00606A,B, which encompass
beta-ketoacyl synthases, e.g. FABH_SPIOL, FABH_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 5-325 and 119-322 are similar to FABH_ECOLI and BBS_PHASS domains concerned with
fatty acid synthase (KAS) and acyltransferase.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
71
transmembrane  
79  
99
transmembrane  
106  
139

PDB Hit:
None.

Gene Protein Sequence:
MRASIWGTGSYLPKKILTNADLEKIVETSDEWISTRTGIKERRIASAEEF
SSFMGAKAAEKAIEAAKISKSQVDCIVFSTAAPDYIFPSSAALAQAYLGI
KEIPAFDCLAACTGFLYGLSIAKAYVESGMYQCVLVIAADKLSSFVNYQD
RNTCVLFGDGGSACIVGHSRPGALEISKVNLGADGKQGDLLRLPAGGSRC
PASQDTVQNHQHFITMEGKEVFKHAVRRMEFAAKTCITEAGLQEKDIDWL
VPHQANERIIDAIAKRFAVKDSRVFKTLAKYGNTAASSVGIALDELLRTH
DIHVAERLLLVAFGGGLSWGAVILQQV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAGCTTCGATCTGGGGAACTGGTTCGTATTTGCCTAAGAAAATTTT
GACAAACGCTGATTTGGAAAAAATAGTTGAAACTTCTGACGAATGGATTT
CGACTAGAACTGGAATCAAGGAGCGTAGAATAGCTTCTGCTGAGGAGTTT
TCGTCTTTTATGGGGGCTAAGGCGGCAGAAAAGGCTATAGAAGCGGCTAA
AATCTCTAAAAGTCAAGTGGACTGTATTGTATTTTCTACTGCCGCGCCTG
ATTATATTTTCCCTTCCAGTGCTGCCTTAGCTCAAGCCTATTTGGGAATT
AAGGAAATTCCAGCCTTTGATTGCTTGGCCGCGTGTACAGGGTTTCTTTA
CGGATTGTCCATAGCCAAGGCATATGTCGAATCTGGGATGTATCAGTGTG
TGCTTGTGATTGCGGCCGACAAGTTGTCTTCCTTTGTTAACTATCAGGAT
CGTAATACTTGTGTGTTATTCGGGGATGGAGGGTCTGCGTGTATTGTTGG
TCATTCTAGACCAGGAGCTTTAGAAATCTCTAAAGTGAATTTAGGAGCGG
ATGGAAAACAAGGAGATCTTTTACGGTTGCCAGCAGGAGGTAGTCGTTGT
CCGGCTTCTCAGGATACCGTACAGAATCATCAACATTTCATTACTATGGA
AGGTAAAGAAGTGTTTAAGCACGCAGTGCGACGAATGGAGTTTGCTGCCA
AGACTTGCATTACAGAAGCTGGGCTGCAAGAAAAAGATATAGATTGGTTA
GTTCCTCATCAGGCAAATGAGCGTATTATCGATGCTATTGCAAAACGTTT
TGCTGTTAAAGACTCTCGGGTATTTAAAACTCTTGCTAAGTATGGTAACA
CAGCAGCCTCTTCTGTGGGGATTGCTTTAGACGAACTTTTACGTACACAT
GATATCCATGTTGCGGAGCGGTTGTTGTTAGTAGCTTTTGGGGGAGGCTT
ATCTTGGGGAGCAGTGATTTTACAGCAAGTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy