Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR198 IGR195 IGR194 IGR196 IGR193 IGR199 IGR197 IGR200 acpP, - CT236 fabG, - CT237 fabD,tfpA, - CT238 fabH, - CT239 incB, - CT232 CT235 incC, - CT233 recR, - CT240 CT241 CT234 acpP, - CT236 fabG, - CT237 fabD,tfpA, - CT238 fabH, - CT239 incB, - CT232 CT235 incC, - CT233 recR, - CT240 CT241 CT234 acpP, - CT236 fabG, - CT237 fabD,tfpA, - CT238 fabH, - CT239 CT235 incC, - CT233 recR, - CT240 CT241 CT234 incB, - CT232
* Calculated from Protein Sequence

Gene ID: CT237

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fabG  

Definition:
3-oxyacyl [acyl-carrier protein] reductase

Gene Start:
265050

Gene Stop:
264307

Gene Length:
744

Molecular Weight*:
26006

pI*:
8.06

Net Charge*:
0.90

EC:
1.1.1.100  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Lipid Metabolism; Fatty acid biosynthesis

Comment:
See CT104, CT532, CT770, and CT236, CT237, CT238, and CT239, all related to fatty acid synthesis and the latter apparently members of an operon.

Blast Summary:  PSI-Blast Search
Numerous hits in Psi-BLAST to acyl-carrier protein reductase sequences,
e.g., residues 4-247 are 51% similar to FAGB_BACSU, 48% similar to FABG_ECOLI,
and 40% similar to NODG_AZOBR. No similarities to T.pallidum or M.genitalium.

CT237 is orthologous to CPn0296: residues 5-247 are 66% similar to CPn0296 and similar to PG1095 of P.gingivalis.

COGS Summary:  COGS Search
BeTs to 12 clades of COG1028
COG name: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Functional Class:  R
The phylogenetic pattern of COG1028 is a--KYQVCEBRHUJ----inX
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 8-20, 21-58, 84-94, 137-174, and 179-188 have significant matches
to blocks BL00061A,B,C,D, which encompass short-chain alcohol dehydrogenase
sequences. Domain matches to YOXD-BACSU, FABG_HAEIN, FABG_ARATM, and HDHA_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 5-230 of CT237 are approximately 29% similar to dehydrogenase/reductase
domain seen in YM71_YEAST. Other regions corresponding to domains found
in dehydrogenase alcohol reductase sequences are represented by residues
5-56, 5-36, 8-48, 10-68, 86-146 and 146-169.

Paralogs:  Local Blast Search
Appears to be paralogously related to CT104: residues 5-246 are approximately
24% similar to CT104, thought to be an enoyl-acyl carrier protein reductase.
(low score, 55, but reasonable Evalue of 3e-09.). Both enzymes are involved in reductive
steps in fatty acid biosynthesis.

Pfam Summary:  Pfam Search
Residues 10 to 247 (E-value = 3.3e-94) place CT237 in the adh_short family which is described as short chain dehydrogenase (PF00106)

PDB Hit:
gi|640224|pdb|2HSD|A Chain A, 3 Alpha, 20 Beta-Hydroxysteroid Dehydrogenase (Holo Form) (E.C.1.1.1.53)

Gene Protein Sequence:
MSGLLVNKTAIVTGGSRGIGFSIAKLFAEQGANVQIWGINGEAGQAAAQT
LSEQTGRQVSFALVDVSKNDMVSAQVQNFLAEYNTIDVIVNNAGITRDAL
LMRMSEEEWSSVINTNLGSIYNVCSAVIRPMIKARSGAIINISSIVGLRG
SPGQTNYAAAKAGIIGFSKALSKEVGSKNIRVNCIAPGFIDTDMTKSLND
NLKNEWLKGVPLGRVGMPEEIAKAALFLASDGSSYITGQVLSVDGGMA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGGTTTATTGGTAAACAAGACTGCAATTGTGACTGGCGGTTCTAG
AGGCATAGGGTTCAGTATAGCGAAGTTATTCGCTGAGCAAGGGGCTAATG
TCCAAATCTGGGGAATTAATGGGGAAGCGGGGCAGGCGGCTGCTCAGACT
CTCTCTGAGCAAACTGGAAGACAAGTATCCTTTGCTCTTGTTGATGTCAG
CAAGAATGATATGGTTTCCGCACAAGTTCAGAACTTTCTTGCGGAGTATA
ACACTATCGATGTTATAGTTAACAATGCGGGGATTACGCGTGATGCTCTT
CTTATGCGAATGTCTGAAGAAGAATGGTCTTCGGTAATTAACACCAACTT
AGGTTCTATATACAACGTTTGCTCAGCAGTTATAAGACCTATGATTAAAG
CTAGATCTGGGGCAATTATTAATATTAGTTCTATTGTAGGACTTAGAGGG
AGCCCAGGTCAGACGAATTATGCAGCAGCTAAGGCTGGAATTATTGGATT
CAGTAAAGCGTTATCCAAAGAAGTTGGAAGTAAGAATATACGAGTCAATT
GTATTGCTCCTGGTTTCATAGATACTGATATGACCAAGAGCTTGAATGAT
AATTTGAAAAATGAGTGGTTGAAAGGAGTTCCTTTGGGAAGAGTTGGTAT
GCCTGAAGAAATTGCTAAGGCCGCTTTGTTCTTAGCTTCTGACGGATCTT
CGTACATCACAGGGCAAGTTTTGAGTGTTGACGGAGGTATGGCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy