Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Val-1 tRNA-Asp-1 IGR181 IGR177 IGR185 IGR179 IGR180 IGR183 IGR178 IGR176 IGR184 CT221.1 CT225 CT222 CT224 CT223 yqfU, - CT221 ubiX, - CT220 CT217 surE, - CT218 ubiA, - CT219 CT215 xasA, - CT216 CT221.1 CT225 CT222 CT224 CT223 yqfU, - CT221 ubiX, - CT220 CT217 surE, - CT218 ubiA, - CT219 CT215 xasA, - CT216 CT222 CT224 CT223 yqfU, - CT221 CT221.1 CT225 ubiX, - CT220 CT217 surE, - CT218 ubiA, - CT219 CT215 xasA, - CT216
* Calculated from Protein Sequence

Gene ID: CT219

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ubiA  

Definition:
4-hydroxybenzoate octaprenyltransferase

Gene Start:
247889

Gene Stop:
248794

Gene Length:
906

Molecular Weight*:
33603

pI*:
9.43

Net Charge*:
11.23

EC:
2.5.1.-  

Functional Class:
cofactor biosynthesis; ubiquinone and quinones  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Ubiquinone biosynthesis

Comment:
The UBIA enzyme catalyzes the prenylation of para-hydroxybenzoate, a
necessary step in the biosynthesis of coenzyme Q (ubiquinone). The ubiA and ubiX genes
are apposed, as in B. firmus (see CT220). Note the abundance of predicted
transmembrane domains. See also CT428.

Blast Summary:  PSI-Blast Search
Several hits in Psi-BLAST to 4-hydroxybenzoate octaprenyltransferase proteins,
e.g. 30% similarity to the Archaeoglobus and Bacillis enzymes, 22% similarity
to UBIA_ECOLI. No similarities to T.pallidum or M.genitalium.

CT219 is orthologously related to CPn0265: residues 10-292 are 42%
similar to CPn0265.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0382
COG name: 4-hydroxybenzoate octaprenyltranferase
Functional Class:  H
The phylogenetic pattern of COG0382 is AmTkyq-Ce---uj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Closest domain observed in COQ2_SCHPO: residues 115-212 of CT219 are 30% similar to this protein
domain. The corresponding E.coli domain is in the UBIA protein, a
4-hydroxybenzoate octaprenyltransferase.

Paralogs:  Local Blast Search
No evidence of paralogs in the C. trachomatis genome,

Pfam Summary:  Pfam Search
Residues 20 to 296 (E-value = 1e-70) place CT219 in the UbiA family which is described as UbiA prenyltransferase family (PF01040)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
15  
42
transmembrane  
46  
67
transmembrane  
95  
125
transmembrane  
129  
157
transmembrane  
161  
190
transmembrane  
215  
234
transmembrane  
238  
257
transmembrane  
279  
301

PDB Hit:
none

Gene Protein Sequence:
MSKIVLIQQLIKCKYALFAALFLASSTLFCFSLPCTPFSLFSLGSIKTIS
LGGSAFFIARALGMIVNQVVDCAIDKRNPRTQSRVLPTELLSIKHSMLLL
TLCLILFLSTCWLFNPLCFSLAVLSTLIMIIYPYTKRFTFLCHWILGLVY
YLAILMNFFAIIETPSFSLFCMSSLLGISFGMIIAANDIIYALQDVEFDQ
KEGLFSIPARFGTKQAITIASANLIASAIAYLLIGYFVPNKTIFYLCSLV
PLTGILRTIKHYSLIDPRAKSTLQQNFFLGNLSLGIAFFANMIGLFLLRG
IL

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTAAGATTGTATTGATTCAGCAGCTTATCAAATGCAAATATGCTTT
GTTTGCAGCACTATTTCTTGCATCTTCTACATTGTTCTGCTTTTCTCTCC
CTTGCACCCCTTTTTCTCTCTTTTCCTTAGGCTCTATAAAAACGATCTCT
CTAGGTGGAAGTGCATTTTTTATCGCCCGCGCTTTAGGAATGATCGTAAA
CCAAGTTGTGGACTGTGCTATTGATAAACGCAACCCTCGCACCCAATCAC
GGGTACTTCCTACAGAGCTTCTTTCAATTAAACATTCCATGCTGCTTCTG
ACTCTCTGTCTTATCCTGTTTCTAAGCACTTGTTGGCTATTCAATCCTCT
TTGCTTTTCTCTCGCAGTCTTATCTACCCTAATTATGATTATCTACCCTT
ACACAAAGCGTTTTACGTTTCTTTGTCACTGGATTTTGGGGCTGGTATAC
TATCTAGCAATACTCATGAACTTTTTTGCCATCATTGAGACTCCTTCTTT
CTCTCTATTTTGCATGAGTTCTTTATTAGGAATTTCCTTTGGTATGATCA
TTGCAGCAAATGATATCATTTATGCACTGCAAGACGTAGAGTTTGATCAA
AAAGAAGGCCTGTTTAGCATTCCTGCTCGATTTGGAACGAAACAAGCTAT
TACAATTGCTTCAGCTAATTTAATAGCTAGCGCAATAGCTTACCTTCTTA
TTGGTTATTTTGTTCCGAATAAAACCATCTTCTATCTATGCTCGCTTGTG
CCTTTAACCGGTATTCTTCGCACAATTAAGCACTATTCTCTTATTGACCC
AAGGGCTAAGTCTACTCTTCAACAAAATTTCTTTCTTGGGAACCTTTCCC
TAGGTATCGCGTTTTTTGCTAATATGATTGGACTATTTTTACTAAGAGGA
ATCTTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy