Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR177 IGR174 IGR175 IGR179 IGR180 IGR178 IGR176 yqgE, - CT211 rpiA, - CT213 CT214 ubiX, - CT220 CT217 surE, - CT218 ubiA, - CT219 CT215 hemL, - CT210 xasA, - CT216 yqgE, - CT211 rpiA, - CT213 CT214 ubiX, - CT220 CT217 surE, - CT218 ubiA, - CT219 CT215 hemL, - CT210 xasA, - CT216 yqgE, - CT211 rpiA, - CT213 CT214 yqdE, - CT212 yqdE, - CT212 ubiX, - CT220 CT217 surE, - CT218 ubiA, - CT219 CT215 hemL, - CT210 xasA, - CT216
* Calculated from Protein Sequence

Gene ID: CT215

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
fructose-bisphosphate aldolase class I (FBP aldolase)

Gene Start:
243477

Gene Stop:
244520

Gene Length:
1044

Molecular Weight*:
37975

pI*:
6.77

Net Charge*:
-1.11

EC:
4.1.2.13  

Functional Class:
energy metabolism; glycolysis and gluconeogenesis  

Pathway: pathway table
Carbon fixation
Fructose and mannose metabolism
Glycolysis / Gluconeogenesis
Pentose phosphate cycle

Comment:
Possible 1,6-fructose biphosphate aldolase (dhnA/fba).

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to poorly characterized sequences, e.g.,
residues 1-348 of CT215 are 60% similar to a hypothetical E. coli
protein that is itself similar to another E.coli protein:
AE000299. Possible members of the dehydrin family. No similarities to
T.pallidum or M.genitalium.

CT215 is similar to CPn0281, a Predicted 1,6-Fructose Biphosphate Aldolase:
residues 1-348 are 79% similar to CPn0281.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1830
COG name: DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes
Functional Class:  G
The phylogenetic pattern of COG1830 is AMtk-q--E---------in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MTTIFDLLGKDADYLLNHKCVIKKEALTLPSGDLVSRVFAESDRNNRVLR
SLQQMFSCGRLGGTGYLSILPVDQGVEHTAGASFAKNPMYFDPENIVRLA
MEAGCSAVASSYGVLSILARRYAHKIPFLLKLNHNELLSYPTTYHQIFFS
QVEDAYNMGAVAVGATIYFGSESSSEEIVAVAEAFARARELGLATVLWCY
LRNPHFVVNNVDYHTAADLTGQADHLGATLGADIVKQKLPTLQGGFKTIN
FSKTDDLVYSELSSNHPIDLCRYQVLNSYCGKVGLINSGGPSGQDDFAEA
VKTAVINKRAGGMGLILGRKAFQRPFSEGVRLLNLIQDIYLDPTISIS

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAACGATTTTTGATCTTCTTGGTAAAGACGCCGACTATCTCCTTAA
CCACAAGTGTGTTATAAAAAAAGAAGCTTTAACGCTTCCTTCTGGAGACC
TCGTATCACGAGTTTTTGCAGAATCAGACAGAAATAATCGGGTGCTCCGT
TCCCTTCAACAGATGTTCAGTTGTGGACGCTTAGGCGGAACAGGATACCT
CTCTATTCTCCCTGTTGACCAAGGTGTCGAACATACTGCAGGCGCATCGT
TTGCCAAGAATCCTATGTACTTTGATCCAGAAAATATCGTGCGTCTGGCT
ATGGAAGCTGGCTGTTCCGCGGTAGCTTCTTCCTATGGCGTGTTAAGTAT
ATTGGCTAGACGATATGCTCATAAAATTCCTTTTTTACTTAAACTAAACC
ACAACGAACTGCTATCCTACCCGACAACATATCACCAAATCTTCTTCAGT
CAAGTTGAAGATGCCTATAATATGGGAGCTGTTGCTGTCGGAGCAACGAT
TTACTTTGGATCAGAGTCTTCTTCTGAAGAAATTGTTGCTGTTGCCGAAG
CTTTTGCAAGAGCTAGAGAGCTTGGCTTGGCTACAGTGTTATGGTGCTAT
TTAAGGAATCCACATTTTGTTGTGAATAATGTGGATTACCACACTGCTGC
CGATTTAACAGGGCAAGCGGACCATCTTGGAGCAACTTTAGGAGCTGATA
TCGTTAAGCAAAAGCTCCCAACTCTTCAAGGAGGATTTAAAACAATTAAT
TTCAGCAAGACTGATGATCTTGTGTACTCGGAGCTTTCATCAAACCACCC
TATTGACCTCTGTCGGTACCAGGTACTTAATAGTTACTGTGGAAAGGTTG
GTCTAATTAACTCCGGAGGCCCTTCTGGGCAAGATGACTTTGCTGAAGCA
GTTAAAACAGCAGTAATTAATAAACGAGCTGGTGGCATGGGACTGATTTT
AGGGAGAAAAGCTTTCCAGAGACCCTTCTCTGAAGGCGTCCGGTTACTCA
ATTTAATTCAAGATATTTATTTAGATCCGACAATCTCCATATCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy