Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR177 IGR174 IGR175 IGR178 IGR173 IGR176 yqgE, - CT211 rpiA, - CT213 CT214 leuS, - CT209 CT215 hemL, - CT210 xasA, - CT216 yqgE, - CT211 rpiA, - CT213 CT214 leuS, - CT209 CT215 hemL, - CT210 xasA, - CT216 yqgE, - CT211 rpiA, - CT213 CT214 leuS, - CT209 yqdE, - CT212 yqdE, - CT212 CT215 hemL, - CT210 xasA, - CT216
* Calculated from Protein Sequence

Gene ID: CT213

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpiA  

Definition:
ribose 5-phosphate isomerase

Gene Start:
241435

Gene Stop:
240710

Gene Length:
726

Molecular Weight*:
26632

pI*:
5.29

Net Charge*:
-3.65

EC:
5.3.1.6  

Functional Class:
energy metabolism; pentose phosphate cycle  

Pathway: pathway table
Carbohydrate Metabolism; Pentose phosphate cycle
Energy Metabolism; Carbon fixation

Comment:
This enzyme converts D-ribose 5-phosphate to D-ribulose 5-phosphate as part
of the nonoxidative branch of the pentose phosphate pathway.

Blast Summary:  PSI-Blast Search
Numerous hits in Psi-BLAST to ribose-5-phosphate isomerase
sequences, e.g., residues 17-237 of CT213 are 39% similar to
the M. janneschii enzyme. CT213 is similar to TP0616 of T.pallidum,
a predicted ribose-5-phosphate isomerase. No similarity found to M.
genitalium.

CT213 is orthologously related to CPn0141, a predicted Ribose-5-P Isomerase A: residues
18-236 are 56% similar to CPn0141.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0120
COG name: Ribose 5-phosphate isomerase
Functional Class:  G
The phylogenetic pattern of COG0120 is amtky--ce--h----olin-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Significant match to blocks BL00894A,B, which encompass bacterial regulatory
proteins (deoR family proteins): residues 17-63 and 17-50 of CT213 are
relevant. AGAR_ECOLI is a representative member of this block.

ProDom Summary:  Protein Domain Search
Closest domain observed in RPIA_ECOLI: residues 17-216 have 38% similarity
to this E. coli sequence.


Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
Residues 61 to 233 (E-value = 2.9e-85) place CT213 in the Rib_5-P_isom_A family which is described as Ribose 5-phosphate isomerase A (phosphoriboisomerase A) (PF06026)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
121

PDB Hit:
none

Gene Protein Sequence:
MSKQPENSFSSDKFFPIKQKLALEAVALVEPGMCVGLGSGSTAREFILAL
GDRVRTERLVITAVASSRISQLLAEAVGIPLSDHSLLQDVDLVVDGADEV
DPCLRMIKGGGGALFREKILLQSGKRNVILVDERKLVPTLGKFSLPIEIA
PFGCSSVQRILNKQGYFGEWRETSAGERFITDNGNYIYDVRTPDSYANPE
EDMIRLLQIRGIIDVGFVIAKAEVWVGYADGSIVRKKEHNEY

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTAAACAACCCGAGAACTCTTTTTCTTCCGACAAATTTTTCCCTAT
CAAGCAGAAACTAGCGCTAGAGGCAGTAGCTTTGGTGGAGCCAGGAATGT
GTGTGGGGTTAGGGAGCGGCTCGACGGCTAGAGAGTTCATTTTGGCTTTA
GGAGATCGTGTTCGGACAGAACGTTTGGTAATCACAGCGGTAGCCTCTTC
AAGGATATCTCAGCTATTAGCTGAAGCAGTGGGGATTCCTTTATCGGATC
ATTCTTTATTGCAAGATGTAGACTTGGTCGTGGATGGAGCGGATGAAGTT
GATCCTTGCTTACGTATGATCAAAGGAGGAGGGGGAGCTCTTTTCCGAGA
AAAAATTCTTCTTCAGAGCGGGAAGCGCAATGTTATTCTAGTAGATGAAA
GGAAACTTGTTCCCACATTAGGGAAGTTTTCATTGCCTATAGAGATTGCT
CCTTTTGGTTGCTCTTCTGTACAGAGGATATTGAATAAACAGGGATACTT
TGGAGAATGGAGAGAAACTTCTGCAGGAGAACGTTTTATCACGGATAATG
GCAATTATATTTACGATGTGCGTACACCCGATTCCTATGCGAATCCCGAA
GAGGATATGATTAGACTATTACAAATTCGTGGCATTATTGATGTCGGGTT
TGTTATAGCAAAAGCCGAGGTGTGGGTAGGTTACGCCGACGGTTCTATTG
TCCGAAAAAAAGAACATAATGAATAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy