Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Met-2 tRNA-Met-1 IGR174 IGR175 IGR173 IGR172 IGR176 yqgE, - CT211 rpiA, - CT213 gseA,kdtA, - CT208 CT214 leuS, - CT209 CT215 hemL, - CT210 pfpB?,pfpA, - CT207 yqgE, - CT211 rpiA, - CT213 gseA,kdtA, - CT208 CT214 leuS, - CT209 CT215 hemL, - CT210 pfpB?,pfpA, - CT207 yqgE, - CT211 rpiA, - CT213 gseA,kdtA, - CT208 CT214 leuS, - CT209 yqdE, - CT212 yqdE, - CT212 CT215 hemL, - CT210 pfpB?,pfpA, - CT207
* Calculated from Protein Sequence

Gene ID: CT210

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemL  

Definition:
glutamate-1-semialdehyde 2,1-aminomutase

Gene Start:
238422

Gene Stop:
239687

Gene Length:
1266

Molecular Weight*:
45930

pI*:
6.56

Net Charge*:
-3.24

EC:
5.4.3.8  

Functional Class:
cofactor biosynthesis; heme and porphyrin  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Porphyrin and chlorophyll metabolism

Comment:
This enzyme is involved in the porphyrin biosynthesis via the C5 pathway;
it is pyridoxal phosphate dependent.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped and Psi-BLAST to glutamate-1-semialdehyde 2,1-aminomutase
sequences, e.g., to the Synechocystis enzyme, to GSA_TOBAC,
to GSA2_ARATH. Residues 4-410 are 41% similar to GSA_PSEAE. No similarities
to T.pallidum or M.genitalium. Similar to PG1122 of P.gingivalis.

CT210 is orthologously related to CPn0138: residues 5-419 are 56% similar to CPn0138.


COGS Summary:  COGS Search
BeTs to 10 clades of COG0001
COG name: Glutamate-1-semialdehyde aminotransferase
Functional Class:  H
The phylogenetic pattern of COG0001 is amt--q-ceBr-uj----in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Significant matches to blocks BL00600A,B,C,D, which encompass aminotransferases,
e.g. the E. coli acetylornithine aminotransferase. Residues 75-109,
171-186, 238-277, and 324-342 of CT210 are relevant.

ProDom Summary:  Protein Domain Search
Closest domain observed in GSA_PROFR: residues 46-149 display 47% similarity to this
sequence. Other amino transferase glutamate-1-semialdehyde domains are
GSA_XANCH (45% similar to residues 251-345), GSA_ECOLI (54% similar to residues 367-401,
GSA_PSEAE (45% similar to residues 199-235).

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
Residues 21 to 419 (E-value = 1.7e-56) place CT210 in the Aminotran_3 family which is described as Aminotransferase class-III (PF00202)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
196  
215

PDB Hit:
gi|2982001|pdb|2GSA|A Chain A, Crystal Structure Of Glutamate-1-Semialdehyde Aminomutase (Aminotransferase, Wild-Type Form) Chlorophyll Biosynthesis, Pyridoxal-5'-Phosphate, Pyridoxamine-5'-Phosphate, Asymmetric Dimer Mol_id: 1; Molecule: Glutamate Semial

Gene Protein Sequence:
MSHLFSKACQYFPGGVNSPVRACRAVNITPPIVARASKEVFVDSLDKTFI
DFCGSWGSLIHGHSHPKICTAIRQGLERGSSYGLTSEQEILFAEEIFSYL
GLETNYKIRFMSTGSEATMTAVRLARGITGRPIIIKFLGCYHGHADTFLQ
EKPFSHTSLETLDLAHPLTLSLPFNDFPLFQTVMNSLGHKVAGVIFEPVC
ANMGVILPVPGFIEGVIQTCQQTGSFSIMDEVVTGFRVAQGGAAALYHVK
PDILVFGKILGGGLPASAVVTPKDIMDHLAPEGKIFQAGTLSGNPLAMIA
GKVSVNLCREQGFYTQLATIEQNFLSPIEHMIRTTGIPVTLVRYGSLFSF
FFNPNRPNNLADAQLSDIEAFQKFYQSAFSKGVYLSPSPFEASFLSAAHS
MESLDYAQTALIESLEQVFSLV

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCCACCTCTTCTCTAAAGCCTGTCAATATTTTCCAGGAGGAGTTAA
TTCCCCTGTTAGAGCATGTCGAGCCGTTAATATCACTCCTCCTATAGTAG
CTCGTGCCTCTAAAGAGGTTTTTGTAGATTCTCTGGATAAAACGTTTATA
GACTTTTGTGGATCATGGGGATCTCTTATCCATGGACATAGTCACCCTAA
GATTTGTACAGCTATCCGACAGGGCTTAGAACGAGGAAGTTCTTATGGCC
TCACGTCCGAACAAGAAATTCTCTTTGCCGAAGAAATTTTTTCGTATTTG
GGATTAGAGACAAACTACAAAATTCGCTTCATGTCCACGGGATCGGAAGC
AACTATGACTGCTGTTCGACTTGCTAGAGGTATCACAGGACGACCTATTA
TCATTAAGTTTTTAGGATGCTACCACGGTCATGCAGATACTTTTCTTCAA
GAAAAACCCTTTTCCCATACTTCGCTAGAAACTTTAGACCTCGCTCATCC
TCTTACCCTCTCTCTACCTTTCAATGATTTCCCCTTATTTCAAACTGTTA
TGAATAGCTTGGGGCATAAGGTCGCTGGAGTCATTTTTGAGCCTGTATGT
GCGAATATGGGGGTGATTCTCCCCGTCCCTGGTTTTATTGAAGGAGTTAT
CCAAACCTGCCAGCAGACCGGATCTTTTTCCATTATGGATGAAGTGGTTA
CGGGATTCCGGGTCGCACAAGGTGGAGCTGCGGCTTTGTATCATGTGAAA
CCTGATATTCTTGTTTTTGGGAAAATTTTAGGTGGAGGCTTACCTGCATC
AGCAGTTGTTACACCTAAAGACATTATGGACCATCTGGCACCCGAAGGAA
AAATCTTCCAAGCTGGAACACTTTCAGGAAATCCTTTGGCCATGATCGCA
GGGAAAGTATCTGTCAACTTGTGTCGGGAACAAGGTTTTTACACACAACT
CGCAACTATTGAGCAAAACTTTTTATCCCCTATTGAACACATGATTCGAA
CTACAGGAATCCCTGTTACATTGGTGCGATATGGAAGCCTCTTTTCCTTT
TTCTTTAACCCAAATAGGCCTAACAATCTTGCGGATGCACAACTTAGCGA
TATCGAAGCTTTTCAAAAGTTTTATCAATCTGCTTTCTCAAAAGGAGTAT
ATCTGTCTCCTTCTCCTTTTGAAGCCAGCTTTTTATCCGCAGCTCACTCT
ATGGAAAGTTTAGATTACGCCCAAACTGCATTGATAGAAAGCTTGGAACA
AGTCTTTTCTTTAGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy