Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Met-2 tRNA-Met-1 IGR171 IGR173 IGR172 yqgE, - CT211 gseA,kdtA, - CT208 leuS, - CT209 hemL, - CT210 pfpB?,pfpA, - CT207 pfpA,pfpB?, - CT205 yqgE, - CT211 gseA,kdtA, - CT208 leuS, - CT209 hemL, - CT210 pfpB?,pfpA, - CT207 pfpA,pfpB?, - CT205 yqgE, - CT211 gseA,kdtA, - CT208 leuS, - CT209 hemL, - CT210 pfpB?,pfpA, - CT207 pfpA,pfpB?, - CT205 CT206 CT206
* Calculated from Protein Sequence

Gene ID: CT208

DNA Molecule Name:
1  

Genbank ID:
3328615

Gene Name:
gseA  kdtA  

Definition:
3-deoxy-D-manno-2-octulosonic acid (KDO) transferase

Gene Start:
235769

Gene Stop:
234477

Gene Length:
1293

Molecular Weight*:
49485

pI*:
9.94

Net Charge*:
14.63

EC:
2.-.-.-  

Functional Class:
cell envelope; surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table

Primary Evidence:
Wylie JL, Iliffe ER, Wang LL, McClarty G. 1997. Identification, characterization, and developmental regulation of Chlamydia trachomatis 3-deoxy-D-manno-octulosonate (KDO)-8-phosphate synthetase and CMP-KDO synthetase. Infect Immun. 65(4):1527-30. Medline: 9119498.

Mamat U, Lobau S, Persson K, Brade H. 1994. Nucleotide sequence variations within the lipopolysaccharide biosynthesis gene gseA (KDO transferase) among the Chlamydia trachomatis serovars. Microb Pathog 17(2):87-97. Medline: 7861960.


Secondary Evidence:
Girjes AA, Carrick FN, Lavin MF. 1997. Lipopolysaccharide biosynthesis genes in koala type I Chlamydia: cloning and characterization. Res Microbiol 148(5):413-25. Medline: 9765820.

Belunis CJ, Clementz T, Carty SM, Raetz CR. 1995. Inhibition of lipopolysaccharide biosynthesis and cell growth following inactivation of the kdtA gene in Escherichia coli. J Biol Chem 270(46):27646-52. Medline: 7499229.

Strohmaier H, Remler P, Renner W, Hogenauer G. 1995. Expression of genes kdsA and kdsB involved in 3-deoxy-D-manno-octulosonic acid metabolism and biosynthesis of enterobacterial lipopolysaccharide is growth phase regulated primarily at the transcriptional level in Escherichia coli K-12. J Bacteriol 177(15):4488-500. Medline: 7543480.

Belunis CJ, Mdluli KE, Raetz CR, Nano FE. 1992. A novel 3-deoxy-D-manno-octulosonic acid transferase from Chlamydia trachomatis required for expression of the genus-specific epitope. J Biol Chem 267(26):18702-7. Medline: 1382060.

Comment:
This enzyme, typically seen in Gram-negative bacteria, adds KDO (3-deoxy-D-manno-octulosonic acid) to lipid A precursors, thereby conferring genus-specific epitopes to LPS.
See CT655 and CT182.

Blast Summary:  PSI-Blast Search
CT208 is orthologous to CPn0154: residues 11-430 are 52% similar to CPn0154. Numerous hits in gapped BLAST to chlamydial and other bacterial KDO transferase
sequences, e.g., identical to C. trachomatis sequence g2126394. 51% and 45%
similar to the homologous enzymes in C. pneumoniae and C. psittaci, respectively. 23% similar
to the KdtA product of E. coli and Serratia marcescens. It is highly similar to
GseA sequences from C. psittaci and C. pneumoniae (U72500, Z31593, X80061). Similar to PG1370 of P.gingivalis. No similarities to T. pallidum or M. genitalium.



COGS Summary:  COGS Search
BeTs to 5 clades of COG1519
COG name: 3-Deoxy-D-manno-octulosonic-acid transferase (LPS biosynthesis)
Functional Class:  M
The phylogenetic pattern of COG1519 is -----q--e--huj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Closest domain observed in KDTA_HAEIN: 26% similarity over residues 58-423 of
CT208.

Paralogs:  Local Blast Search
No paralogs were detected in C.trachomatis. This sequence is identical to C. trachomatis sequence g2126394. In Genbank, CT208
is identical or nearly identical to sequences obtained from C. trachomatis serovars: Z22652-Z22656, Z22659 and M64618.

Pfam Summary:  Pfam Search
Residues 36 to 229 (E-value = 6.6e-103) place CT208 in the Glycos_transf_N family which is described as 3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase) (PF04413)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
366  
397

PDB Hit:
None.

Gene Protein Sequence:
MIRRWLTSRLYDAFLVCAFFVSAPRIFYKVFFHGKYIDSWKIRFGVQKPF
VKGEGPLVWFHGASVGEVSLLAPLLNRWREEFPEWRFVVTTCSEAGVHTA
RRLYESLGATVFVLPLDLSCIIKSVVRKLAPDIVIFSEGDCWLHFLTESK
RLGAKAFLINGKLSEHSCKRFSFLKRLGRNYFAPLDLLILQDELYKQRFM
QIGISSDKIHVTGNMKTFIESSLATNRRDFWRAKLQISSQDRLIVLGSMH
PKDVEVWAEVVSHFHNSSTKILWVPRHLEKLKEHAKLLEKAGILFGLWSQ
GASFRQYNSLIMDAMGVLKDIYSAADIAFVGGTFDPSVGGHNLLEPLQKE
VPLMFGPYIYSQSVLAEKLREKEAGLSVNKETLLDVVTDLLQNEKNRQAY
IEKGKSFLKQEENSFQQTWEILKSQITCMKI

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAAGACGTTGGTTAACATCTCGTCTCTATGATGCGTTTTTAGTTTG
CGCTTTTTTTGTTTCGGCGCCACGTATTTTTTACAAAGTGTTTTTCCATG
GGAAATATATTGACTCTTGGAAAATTCGGTTTGGGGTACAGAAACCTTTC
GTGAAAGGGGAAGGCCCTTTAGTTTGGTTTCATGGAGCTTCTGTGGGGGA
AGTCAGTCTGTTGGCTCCCCTTCTTAATCGATGGAGAGAAGAGTTTCCAG
AATGGCGGTTTGTTGTTACAACGTGTTCTGAAGCTGGTGTGCACACCGCT
CGTCGTTTGTATGAATCTCTTGGCGCTACTGTATTTGTTTTACCTCTGGA
TTTAAGTTGTATTATTAAATCCGTGGTTCGCAAGCTTGCTCCTGATATCG
TGATCTTTTCAGAAGGAGACTGTTGGTTACATTTTTTGACAGAATCCAAA
CGTTTAGGGGCAAAAGCCTTTTTGATTAATGGCAAACTTTCGGAACATTC
TTGTAAGCGTTTTTCTTTTTTAAAGCGGTTAGGAAGGAATTATTTTGCTC
CGTTAGATTTATTGATACTACAAGATGAGCTGTATAAACAACGGTTTATG
CAGATAGGTATTTCCTCGGATAAGATTCATGTCACTGGAAACATGAAAAC
GTTTATAGAATCCTCTCTTGCCACAAATCGCCGAGATTTTTGGAGAGCAA
AATTACAAATATCTTCTCAGGATCGCTTAATTGTATTGGGTTCTATGCAT
CCTAAAGATGTAGAGGTATGGGCTGAAGTGGTTTCACATTTCCACAATTC
TTCTACAAAAATTTTATGGGTTCCTAGACATCTTGAGAAGTTAAAGGAGC
ATGCTAAGCTACTAGAAAAGGCTGGGATTTTATTTGGATTATGGAGTCAA
GGTGCTTCTTTCCGGCAGTATAATTCTTTAATTATGGACGCTATGGGGGT
ATTAAAAGATATTTACTCTGCAGCAGATATTGCATTTGTAGGAGGAACTT
TCGATCCATCTGTAGGAGGGCATAATTTATTAGAGCCTCTTCAAAAAGAG
GTGCCTCTTATGTTTGGACCCTATATTTATTCTCAATCTGTTCTTGCTGA
AAAGTTGCGGGAAAAAGAAGCAGGACTTTCTGTGAACAAAGAAACTCTTT
TAGATGTAGTTACAGATCTTCTTCAAAACGAAAAAAACCGCCAAGCTTAT
ATTGAAAAGGGGAAATCTTTTTTGAAGCAGGAAGAAAATAGCTTTCAACA
GACATGGGAAATATTAAAGAGCCAAATTACTTGCATGAAAATC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy