Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR167 IGR170 IGR169 IGR166 IGR164 IGR165 IGR168 CT196 oppF, - CT202 oppC,dppC, - CT200 CT203 oppB, - CT199 ybhI, - CT204 oppA, - CT198 pfpA,pfpB?, - CT205 CT196 oppF, - CT202 oppC,dppC, - CT200 CT203 oppB, - CT199 ybhI, - CT204 oppA, - CT198 pfpA,pfpB?, - CT205 oppF, - CT202 oppC,dppC, - CT200 CT203 oppB, - CT199 ybhI, - CT204 oppA, - CT198 pfpA,pfpB?, - CT205 oppD, - CT201 gcp_2, - CT197 oppD, - CT201 CT196 gcp_2, - CT197
* Calculated from Protein Sequence

Gene ID: CT201

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
oppD  

Definition:
oligopeptide ABC transporter

Gene Start:
225964

Gene Stop:
226794

Gene Length:
831

Molecular Weight*:
30652

pI*:
7.23

Net Charge*:
0.93

EC:
 

Functional Class:
transport and binding; amino acids, peptides and amines  

Pathway: pathway table
Membrane Transport; ATP-binding cassette (ABC) transport system

Comment:
Part of the oligopeptide transport system; an ABC transporter. In B. subtilis,
this protein is required for sporulation.

See CT198, CT199, CT200, CT202, CT203, CT204,
CT478, CT479, CT139, CT175.

For a recent review of ABC transporters, please see Nikaido and Hall. 1998. Overview of bacterial ABC transporters. Methods Enzymol 292:3-20. Medline: 9711542. See also, Linton and Higgins, 1998 (Medline: 9593292), Saier et al., 1998 (Medline: 9506471), and Fath and Kolter, 1993 (Medline: 8302219).

For a complete listing of Chlamydia ABC transporters, alignments of transporters, nucleotide binding domain organization,and plasma membrane organization, please go to: http://www.stdgen.lanl.gov, choose Bacteria under the Analysis heading on the left-side navigation frame, then click on the ABC transporters analysis subsection.

Blast Summary:  PSI-Blast Search
Numerous hits in Psi-BLAST to bacterial oligopeptide ABC transporter proteins, and to hypothetical proteins. For example 5-262 are 40% similar to OPPD_BACSU, oligopeptide transport protein of Bacillus subtilis,(X56347).

CT201 is orthologously related to CPn0201: residues 1-268 are 55% similar to CPn0201. This protein is also similar to PG921 from P. gingivalis, TP0120 from T. pallidum and to MG079 from M. genitalium.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0444
COG name: ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
Functional Class:  E,P
The phylogenetic pattern of COG0444 is a-TKyqV-EB-Hujgpo-IN-
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
Significant match to blocks BL00211A,B and to block PR00193B (spurious?)
which encompass ABC transporters and the myosin heavy chain signature.
Residues 33-49 and 154-185 are relevant to the ABC transporters.

ProDom Summary:  Protein Domain Search
Closest domain observed in P29_MYCPN: 25% similarity over residues 155-228;
also 45% similarity to OPPD_LACLA over residues 83-119.

Paralogs:  Local Blast Search
This protein is paralogously related to 11 other transporter proteins. CT690, CT689, CT202, CT130, CT416, CT152, CT264, CT653, CT068, CT180, and CT685 are all similar to CT201. Scores range from 188 (CT690) to 50 (CT685) with the match to itself receiving a score of 545.

Pfam Summary:  Pfam Search
Residues 33 to 230 (E-value = 4.8e-48) place CT201 in the ABC_tran family which is described as ABC transporter (PF00005)

PDB Hit:
None.

Gene Protein Sequence:
MSEDLLKIDNLVVSVKDSNQRLVNHLSLTIKRCQSMALVGENGSGKTTVS
KAVLGFLPDNCYIQSGRILYSSTDITRLSRRQLQTIRGKKIATIFQNAMG
TLTPSMRVGAQIVETLRHHFDMSKEEAFSKARELLESVHIESPDRCLQLY
PFELSGGMCQRVSIAIALATNPELIIADEPSTALDSISQAQVLRVLTQIH
QNHSTALLLITHNLALVSELCEEMAIIRYGEIVEQGPVQELLHSPSHPYT
QQLIRAIPKIPSPSYLSPKEPLATTAY

Gene Nucleotide Sequence:  Sequence Viewer
TTGTCTGAAGATTTATTAAAAATTGATAATCTAGTCGTCTCCGTAAAAGA
TTCCAATCAACGATTAGTCAATCACTTGTCGCTCACTATCAAGCGATGCC
AAAGTATGGCACTTGTAGGAGAAAATGGTTCGGGGAAAACAACCGTTTCT
AAAGCAGTTTTGGGGTTTCTCCCCGATAATTGTTACATCCAATCTGGAAG
AATCCTTTACTCCAGCACAGATATTACACGCTTATCTCGTAGACAACTTC
AAACAATCCGCGGGAAGAAAATCGCAACTATTTTCCAAAATGCCATGGGA
ACCCTGACTCCTTCTATGCGTGTAGGAGCTCAAATTGTAGAAACCCTAAG
ACATCATTTCGATATGTCTAAAGAAGAAGCTTTCTCTAAAGCAAGAGAAC
TGCTTGAGAGTGTACACATCGAATCTCCTGATCGATGCCTACAATTATAT
CCCTTTGAGCTTAGCGGTGGCATGTGTCAACGAGTTAGCATTGCTATTGC
TCTGGCAACCAATCCGGAACTCATTATTGCAGATGAACCTTCAACAGCGC
TAGATTCTATATCCCAGGCTCAGGTATTGCGTGTACTGACACAAATTCAC
CAAAACCATTCTACAGCTCTACTACTCATCACTCATAATTTAGCTTTAGT
ATCTGAACTGTGTGAAGAAATGGCCATTATACGCTATGGGGAGATCGTTG
AGCAAGGTCCTGTGCAAGAGCTACTGCACTCTCCGTCTCATCCTTATACC
CAGCAACTGATCCGCGCTATTCCTAAAATTCCTAGTCCTAGCTATCTTTC
ACCTAAAGAACCTCTTGCAACAACCGCGTAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy