Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR167 IGR166 IGR164 IGR161 IGR165 IGR163 IGR162 CT195 tgt, - CT193 mgtE, - CT194 CT196 oppF, - CT202 oppC,dppC, - CT200 oppB, - CT199 oppA, - CT198 CT195 tgt, - CT193 mgtE, - CT194 CT196 oppF, - CT202 oppC,dppC, - CT200 oppB, - CT199 oppA, - CT198 CT195 tgt, - CT193 mgtE, - CT194 CT196 oppC,dppC, - CT200 oppB, - CT199 oppA, - CT198 oppD, - CT201 gcp_2, - CT197 gcp_2, - CT197 oppF, - CT202 oppD, - CT201
* Calculated from Protein Sequence

Gene ID: CT197

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gcp_2  

Definition:
O-sialoglycoprotein endopeptidase (glycoprotease)

Gene Start:
221458

Gene Stop:
222471

Gene Length:
1014

Molecular Weight*:
35909

pI*:
6.50

Net Charge*:
-1.98

EC:
3.4.24.57  

Functional Class:
translation; proteases  

Pathway: pathway table

Comment:
In E.coli this enzyme is thought to be a metalloprotease with zinc-binding
potential.

From Prosite PDOC00779:

Glycoprotease (GCP) (EC 3.4.24.57), or o-syaloglycoprotein endopeptidase, is a metalloprotease secreted by Pasteurella haemolytica which specifically cleaves O-sialoglycoproteins such as glycophorin A.

O-sialoglycoprotein endopeptidase is a neutral metalloprotease that cleaves
specifically o-sialoglycoproteins such as glycophorin A (cleaving,
specifically,
the 31-arg-|-asp-32 bond). O-sialoglycoprotein endopeptidase will not cleave
unglycosylated proteins, desialylated glycoproteins or glycoproteins that are
only N-glycosylated.
Zinc is probably a cofactor. This protein is probably extracellular, however it is not secreted through
the conventional secretory pathway since it lacks a signal sequence.
This protein is a member of the peptidase family M22; also known as the
glycoprotease family.

Blast Summary:  PSI-Blast Search
Numerous matches to O-sialogycoprotein endopeptidases, e.g.
37% similarity to the enzyme from HAEIN. Other examples are GCP_PASHA
and YGJD_ECOLI. CT197 is similar to TP0680, a predicted endopeptidase from T.pallidum,
and to MG046, a sialoglycoprotease from M.genitalium.

CT197 is orthologously related to CPn0194: residues 1-335 of CT197 are 65%
similar to residues 1-335 of CPn0194, a predicted gcp O-sialoglycoprotein endopeptidase (glycoprotease) from C. pneumoniae, and PG1502 of P.gingivalis.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0533
COG name: Metal-dependent proteases with possible chaperone activity
Functional Class:  O
The phylogenetic pattern of COG0533 is amtkYQvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Significant matches to blocks BL01016A,B,C,D,E,F, which encompass
glycoprotease family proteins. Residues 16-30, 51-79, 83-127, 142-154,
162-186, and 276-295 of CT197 are relevant to these blocks.

ProDom Summary:  Protein Domain Search
Closest domain observed in GCP_HAEIN, with residues 173-277
of CT197 displaying 40% similarity. Residues 41-110 manifest 41%
similarity to GCP_HAEIN. Residues 112-169 are 45% similar to
GCP_MYCPN.

Paralogs:  Local Blast Search
Very weak similarity to CT343, thought to have O-endopeptidase
function.

Pfam Summary:  Pfam Search
Residues 2 to 283 (E-value = 2.7e-88) place CT197 in the Peptidase_M22 family which is described as Glycoprotease family (PF00814)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
78  
95
transmembrane  
125  
145

PDB Hit:
none

Gene Protein Sequence:
MLTLGLESSCDETSCSLVQNGKILANKIASQDIHASYGGVIPELASRAHL
QTFPELLTAATQSAGVSLEDIELISVANTPGLIGALSIGVNFAKGLASGL
KRPLIGVNHVEAHLYAACMEAPATQFPALGLAISGAHTSLFLMPDATTFL
LIGKTRDDAIGETFDKVARFLGLPYPGGQKLEELAREGDADAFAFSPARV
SGYDFSFSGLKTAVLYALKGNNSSAKAPFPEVSETQKRNIAASFQKAVFM
TIAQKLPDIVKTFSCESLIVGGGVANNSYFRRLLNQICSLPIYFPSSQLC
SDNAAMIAGLGERLFCNRTHVSKEVIPCARYQWESACS

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGACACTAGGCTTAGAAAGTTCTTGCGATGAAACATCCTGTTCTCT
TGTCCAGAACGGGAAAATCTTAGCAAATAAAATTGCTTCTCAAGACATTC
ATGCTTCTTATGGAGGAGTGATCCCTGAATTAGCTTCTCGCGCTCATCTA
CAAACATTCCCAGAACTGCTGACTGCAGCGACGCAAAGCGCGGGAGTCTC
TTTGGAAGATATCGAATTAATTTCGGTAGCTAATACTCCTGGTCTTATTG
GAGCCCTATCTATCGGTGTAAACTTTGCAAAAGGGTTGGCAAGTGGGCTG
AAAAGACCTCTCATAGGAGTGAACCATGTAGAAGCGCATTTATATGCCGC
TTGCATGGAAGCTCCCGCCACTCAATTCCCTGCTCTAGGGCTTGCTATTT
CTGGTGCCCATACATCTCTATTTCTCATGCCTGATGCCACAACTTTCCTT
TTAATAGGAAAGACTCGAGATGATGCTATTGGCGAGACTTTTGATAAAGT
AGCTCGTTTTCTCGGCTTGCCTTACCCAGGAGGACAAAAATTAGAAGAAT
TAGCTCGAGAAGGTGATGCAGATGCATTTGCCTTTTCTCCAGCTCGAGTT
TCTGGTTATGATTTCTCTTTCAGTGGACTAAAAACAGCCGTCTTATATGC
TTTAAAAGGCAACAACAGCTCAGCAAAAGCACCTTTTCCTGAAGTCTCTG
AAACACAGAAACGAAACATTGCAGCATCGTTTCAAAAAGCTGTTTTTATG
ACTATTGCTCAAAAACTTCCTGATATTGTAAAAACGTTTTCTTGCGAGTC
TTTGATTGTTGGTGGGGGCGTAGCAAACAACAGTTACTTTCGTCGCTTGC
TAAATCAAATATGCTCTCTTCCGATATACTTCCCTTCTTCGCAGTTATGT
TCAGACAACGCTGCAATGATAGCCGGGTTAGGAGAGAGACTGTTTTGCAA
TCGCACACATGTTTCTAAGGAGGTCATTCCATGCGCAAGATATCAGTGGG
AATCTGCTTGCTCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy