Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR158 IGR157 IGR160 IGR164 IGR161 IGR159 IGR163 IGR162 CT191 CT192 CT195 tgt, - CT193 mgtE, - CT194 gyrB, - CT190 gyrA, - CT189 CT196 gcp_2, - CT197 CT191 CT192 CT195 tgt, - CT193 mgtE, - CT194 gyrB, - CT190 gyrA, - CT189 CT196 gcp_2, - CT197 CT191 CT192 CT195 tgt, - CT193 mgtE, - CT194 gyrB, - CT190 gyrA, - CT189 CT196 gcp_2, - CT197
* Calculated from Protein Sequence

Gene ID: CT193

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tgt  

Definition:
tRNA-guanine transglycosylase (queuine tRNA ribosyltransferase))

Gene Start:
217769

Gene Stop:
216654

Gene Length:
1116

Molecular Weight*:
40861

pI*:
8.48

Net Charge*:
8.05

EC:
2.4.2.29  

Functional Class:
translation; tRNA modification  

Pathway: pathway table

Comment:
Queuine is a bacterially synthesized deazaguanine that is inserted
into anticodons of select tRNAs (asp, asn, his, tyr) under
control of the TGT (tRNA-guanine transglycosylase) enzyme.
The TGT enzyme is a virulence factor in Shigella, for instance.


Blast Summary:  PSI-Blast Search
Residues 5-370 are 32 % similar to the tRNA-guanine transglycosylase of B. burgdorferi
(AQE001179). No similarities found to T.pallidum or M.genitalium. Other
similarities are to TGT_BACSU and to TGT_SYNY3.

CT193 is orthologously related to CPn0219: residues 1-372 of CT193
are 75% similar to residues 1-372 of CP0219, a predicted tgt
tRNA-queuine transglycosylase from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0343
COG name: Queuine/archaeosine tRNA-ribosyltransferase
Functional Class:  J
The phylogenetic pattern of COG0343 is AmTk-qvceb-huj--o-inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Significant match to blocks BL00180A,C,D, which encompass
glutamine synthetase sequences: residues 31-75, 232-264, and
246-258 of CT193 are relevant.

ProDom Summary:  Protein Domain Search
Residues 10-371 are 32% similar to a guanine transglycosylase domain as observed in TGT_HELPY and other TGT
sequences.

Paralogs:  Local Blast Search
No significant paralogs detected in the C. trachomatis genome.

Pfam Summary:  Pfam Search
Residues 143 to 371 (E-value = 7.9e-55) place CT193 in the TGT family which is described as Queuine tRNA-ribosyltransferase (PF01702)

PDB Hit:
gi|2392507|pdb|1PUD| Trna-Guanine Transglycosylase Trna-Modifying Enzyme, Transferase, Glycosyltransferase Mol_id: 1; Molecule: Trna-Guanine Transglycosylase; Chain: Null; Synonym: Tgt; Ec: 2.4.2.29; Engineered: Yes

Gene Protein Sequence:
MALRFEILHQSKKSRARVGRIETAHGYIDTPAFVPVATNGALKGVLDHSN
IPLMFCNTYHLIVHPGAEAIAAMGGLHQFIGRNAPIITDSGGFQIFSLAY
GSVAEEIKSCGKKKGGNTIIKVNDDGVHFKSYRDGRKLFLSPEISVQAQK
DLGADIILPLDELLPFHADPTYFHQSSQRTYVWEKRSLDYHLKNPGIQSM
YGVIHGGTFPDQRKLGCKFVEDLPFDGSAIGGSLGKNLQDIVEVVGVTAA
NLSAERPRHLLGIGDLPSIWATVGFGIDSFDSSYPTKAARHGMILTSQGP
LKINNQRYSSDLNPIEPGCSCLACSQGITRAYLRHLFKVHEPNAGIWASI
HNMHHMQKVMREIREGILNDRI

Gene Nucleotide Sequence:  Sequence Viewer
GTGGCTTTACGTTTTGAGATTCTGCATCAATCAAAAAAATCTAGGGCTAG
AGTAGGTCGGATAGAGACGGCGCATGGGTATATTGATACACCGGCTTTTG
TTCCTGTGGCTACAAATGGAGCTCTAAAAGGGGTTTTAGATCATAGCAAT
ATCCCGCTAATGTTTTGCAATACCTATCATCTGATAGTGCATCCGGGAGC
AGAAGCTATTGCTGCTATGGGTGGATTACACCAATTTATTGGTCGCAATG
CGCCTATTATTACAGATTCCGGGGGATTTCAAATTTTTAGCTTGGCATAT
GGTTCTGTAGCTGAAGAGATTAAAAGTTGCGGGAAGAAAAAAGGAGGAAA
CACCATCATTAAAGTTAATGATGACGGGGTACACTTTAAATCCTACCGAG
ATGGCCGTAAGCTATTTCTTTCTCCAGAAATTTCTGTACAAGCGCAGAAA
GATTTGGGCGCTGATATCATTCTTCCTTTAGATGAGCTGCTGCCCTTTCA
TGCAGATCCCACATATTTTCACCAGTCATCTCAACGCACTTACGTTTGGG
AGAAACGTTCTTTGGATTATCATTTAAAAAATCCTGGAATTCAGTCCATG
TACGGAGTCATTCATGGGGGGACTTTCCCTGATCAAAGAAAACTTGGCTG
TAAATTCGTAGAAGATTTGCCTTTCGATGGCTCTGCTATTGGAGGCAGTT
TGGGGAAAAATCTTCAAGATATCGTAGAGGTGGTGGGTGTTACCGCTGCA
AATCTTTCAGCAGAAAGACCTAGACATCTGCTAGGGATAGGAGATTTGCC
CTCTATTTGGGCCACTGTTGGTTTCGGAATAGATTCTTTTGATAGCTCTT
ATCCGACTAAAGCTGCGCGACATGGCATGATTTTGACATCACAAGGCCCT
CTAAAAATTAATAATCAACGGTACTCTTCTGACCTAAATCCTATAGAGCC
TGGGTGTTCATGTCTTGCATGCTCTCAAGGCATAACGCGCGCCTACTTAA
GACATTTGTTCAAAGTACATGAGCCAAATGCGGGTATCTGGGCGTCCATT
CACAACATGCATCATATGCAAAAAGTCATGCGAGAAATTCGAGAGGGAAT
TTTAAATGACCGTATA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy