Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR156 IGR158 IGR155 IGR157 IGR160 IGR161 IGR159 CT191 tdk, - CT188 CT192 dnaX,dnaZ, - CT187 tgt, - CT193 mgtE, - CT194 gyrB, - CT190 gyrA, - CT189 CT191 tdk, - CT188 CT192 dnaX,dnaZ, - CT187 tgt, - CT193 mgtE, - CT194 gyrB, - CT190 gyrA, - CT189 CT191 tdk, - CT188 CT192 dnaX,dnaZ, - CT187 tgt, - CT193 mgtE, - CT194 gyrB, - CT190 gyrA, - CT189
* Calculated from Protein Sequence

Gene ID: CT190

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gyrB  

Definition:
DNA gyrase subunit B (topoisomerase)

Gene Start:
215351

Gene Stop:
212940

Gene Length:
2412

Molecular Weight*:
89769

pI*:
5.33

Net Charge*:
-16.14

EC:
5.99.1.3  

Functional Class:
DNA replication and repair  

Pathway: pathway table

Comment:
The B chain of DNA gyrase is said to perform an ATP hydrolyzing function.
Two A chains (CT189) and two B chains make up the complete gyrase molecule. See CT189.
Just as CT189 is paralogously related to CT660, CT190 is
paralogously related to CT661, another gyrase B subunit gene.

Blast Summary:  PSI-Blast Search
Numerous hits using gapped and Psi-BLAST to DNA gyrase subunit B sequences, e.g.,
GYRB_SALTY (45% similarity), GYRB_HAEIN (45%), GYRB_ECOLI (45%), GYRB_ACSU
(49%). Residues 3-803 are 44% similar to GYRB_PSEPU. CT190 is similar
to TP1006 of T.pallidum and to MG003 of M.genitalium, both predicted gyrase B
sequences.

CT190 is orthologously related to CPn0275, a predicted DNA gyrase subunit B:
residues 1-804 are 81% similar to CT190.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0187
COG name: DNA gyrase (topoisomerase II) B subunit
Functional Class:  L
The phylogenetic pattern of COG0187 is a---yqvCEBrHujGPOlINX
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
Matches to blocks BL00177A,B,C,D,E,F,G, which encompass DNA topoisomerase II
sequences. Residues 19-33 and 77-124 match well with GYRB_ECOLI; other residues
are best matched to GYRB_BACSU and GYRB_HAEIN.

ProDom Summary:  Protein Domain Search
Closest domain seen in GYRB_BACSU: 53% similarity across residues 268-493 of
CT190. Other matches are observed with GYRB-BACSU across residues 47-185 (55%),
with GYRB_HAEIN across residues 503-570 (70%), with GYRB_STRCO across residues 33-71
(84%), with GYRB_HAEIN across residues 734-750 (88%) and 770-796 (74%).


Paralogs:  Local Blast Search
CT190 is paralogously related to CT661, also thought to be a
DNA gyrase subunit B (31% similarity).

Pfam Summary:  Pfam Search
Residues 33 to 182 (E-value = 9.5e-28) place CT190 in the HATPase_c family which is described as Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518)
Residues 230 to 404 (E-value = 5.1e-90) place CT190 in the DNA_gyraseB family which is described as DNA gyrase B (PF00204)
Residues 461 to 543 (E-value = 1.1e-10) place CT190 in the Toprim family which is described as Toprim domain (PF01751)
Residues 725 to 791 (E-value = 3.8e-45) place CT190 in the DNA_gyraseB_C family which is described as DNA gyrase B subunit, carboxyl terminus (PF00986)

PDB Hit:
gi|3212436|pdb|1AJ6| Novobiocin-Resistant Mutant (R136h) Of The N-Terminal 24 Kda Fragment Of Dna Gyrase B Complexed With Novobiocin At 2.3 Angstroms Resolution Topoisomerase, Gyrase, Novobiocin, Antibiotic, Resistant Mutant Mol_id: 1; Molecule: Gyrase;

Gene Protein Sequence:
MDAQEKKYDASAITVLEGLQAVRERPGMYIGDTGVTGLHHLVYEVVDNSI
DEAMAGFCTEVVVRILEDGGISISDNGRGIPIQIHEKESAKQGREISALE
VVLTVLHAGGKFDKDSYKVSGGLHGVGVSCVNALSEKFIAKVFKDGQAYS
MEFSRGAPLTTLQVLGPTDKRGTEVLFYPDPAIFSTCVFDRAILMKRLRE
LAFLNRGVTIVFEDDRDTGFDKVVFFYEGGIQSFVSYLNQNKEILFPNPI
YMQGSRPGDDGDIEFEAALQWNSGYSELIYSYANNIPTRQGGTHLTGFST
ALTRAVNSYIKAHNLSKSDKLSLTGEDIKEGLVAIVSVKVPNPQFEGQTK
QKLGNSDVGSVSQQISGEVLTTFFEENPQIAKTIVDKVFVAAQAREAAKR
ARELTLRKSALDSARLPGKLIDCLEKDPEKCEMYIVEGDSAGGSAKQGRD
RRFQAILPIRGKILNVEKARLQKVFQNQEIGSIIAALGCGIGKDNFNLSK
LRYKRIIIMTDADVDGSHIRTLLLTFFYRHMSALIENECVYIAQPPLYRV
SKKKDFRYILSEKEMDGYLLNLGTKESQIVFDDTLRDLRGEALETFVNLI
LEVESFIVSLEKKAIPFSEFLDMFRDGAYPLYYYPPESGKQGGSYLYSHE
EKEAAIAANEESASRILELYKGSVLEELQRDLGDYGYDIRNYLHPKGSGI
TVSTEDPKISPYVCYTLKEVIDYLKGLGRKGIEIQRYKGLGEMNADQLWD
TTMNPEQRTLVRVSLKDAVEADHIFTMLMGEEVPPRREFIESHALSIRMN
NLDI

Gene Nucleotide Sequence:  Sequence Viewer
ATGGACGCACAAGAAAAGAAATACGACGCATCAGCCATCACCGTTTTAGA
AGGATTGCAAGCTGTTCGTGAGCGTCCTGGAATGTACATTGGTGATACAG
GAGTTACCGGATTGCATCACTTGGTTTATGAAGTGGTGGATAACAGTATC
GATGAGGCAATGGCGGGTTTTTGTACCGAGGTCGTTGTTCGCATATTGGA
AGACGGAGGTATTTCTATTTCGGATAACGGTCGAGGAATTCCTATTCAGA
TTCACGAAAAAGAATCTGCCAAGCAAGGACGCGAAATTTCCGCTTTAGAG
GTGGTTCTTACCGTACTACATGCGGGAGGTAAATTTGATAAAGACAGTTA
TAAGGTTTCTGGAGGCTTGCATGGAGTAGGAGTTTCGTGCGTTAACGCTC
TGTCCGAAAAATTCATTGCAAAAGTATTTAAAGATGGACAAGCGTATAGC
ATGGAGTTTTCAAGAGGCGCTCCGTTAACGACTTTACAGGTGCTTGGTCC
TACAGACAAACGAGGTACAGAAGTTCTCTTTTATCCAGATCCAGCTATAT
TCTCTACGTGCGTCTTTGATCGCGCGATTTTAATGAAGCGTTTGCGAGAA
TTAGCATTTTTAAATCGTGGAGTCACGATTGTTTTTGAAGATGACCGTGA
TACGGGATTTGATAAAGTCGTTTTCTTCTATGAAGGCGGAATTCAATCAT
TCGTCAGTTACCTCAACCAAAATAAAGAAATTCTTTTCCCAAATCCTATT
TATATGCAGGGATCGAGACCTGGAGATGATGGGGATATAGAATTTGAGGC
CGCTTTACAGTGGAATTCTGGTTACTCCGAATTAATCTATTCTTACGCTA
ATAATATTCCTACAAGACAAGGCGGAACTCATTTAACAGGATTTTCTACG
GCTCTTACTCGGGCAGTAAACTCCTATATTAAAGCTCATAATCTATCTAA
AAGTGACAAGTTGTCTTTGACTGGAGAAGACATCAAAGAGGGGCTAGTAG
CAATTGTTTCCGTTAAAGTGCCCAATCCTCAGTTTGAAGGGCAAACAAAA
CAAAAACTTGGAAATAGTGATGTCGGATCGGTTTCTCAGCAAATTAGTGG
TGAGGTGTTAACCACATTTTTTGAAGAAAATCCTCAAATTGCTAAAACGA
TTGTAGACAAGGTGTTCGTTGCAGCCCAAGCTAGAGAAGCTGCTAAGAGA
GCTAGAGAGCTAACTCTTCGGAAAAGTGCTTTAGATAGCGCTCGCTTACC
AGGTAAGTTAATTGACTGCTTGGAAAAAGATCCTGAAAAATGTGAAATGT
ATATTGTGGAAGGAGACTCTGCGGGAGGTTCAGCTAAGCAGGGACGAGAT
CGTCGTTTTCAAGCAATTCTTCCTATTCGTGGTAAGATCCTGAATGTTGA
GAAAGCTCGTTTACAAAAAGTTTTCCAAAACCAGGAAATTGGAAGCATTA
TAGCAGCTTTAGGATGTGGAATTGGGAAGGATAATTTCAACCTCAGCAAA
TTGCGTTATAAACGTATTATTATTATGACAGATGCTGACGTGGACGGTTC
TCATATTCGAACCTTGTTGCTAACATTCTTCTATAGACATATGTCCGCTT
TGATAGAAAATGAATGCGTCTATATTGCGCAACCTCCTTTATATCGAGTG
AGCAAGAAAAAAGATTTCCGTTACATTCTCTCAGAAAAAGAGATGGATGG
CTATTTGCTGAACTTAGGAACAAAAGAAAGCCAGATAGTTTTTGATGACA
CCTTAAGGGATCTGAGAGGGGAAGCTTTAGAAACGTTCGTTAATCTTATT
CTAGAGGTCGAAAGTTTTATTGTTTCTTTAGAGAAAAAAGCGATTCCATT
TTCTGAATTCTTGGATATGTTCCGAGACGGAGCTTATCCTTTGTATTACT
ATCCTCCAGAAAGTGGGAAGCAGGGAGGCAGTTATCTCTATTCTCATGAA
GAGAAGGAAGCAGCTATTGCTGCCAATGAAGAATCTGCTTCGCGGATTTT
AGAATTATATAAAGGTTCTGTTCTCGAAGAACTTCAGCGCGATTTAGGTG
ATTACGGTTACGATATCCGGAATTACCTCCATCCAAAAGGATCTGGTATT
ACAGTTTCTACAGAAGATCCGAAAATATCTCCGTATGTTTGTTACACCTT
GAAAGAGGTAATAGACTACTTAAAAGGCCTTGGAAGAAAAGGAATTGAGA
TTCAACGGTATAAAGGTCTTGGAGAGATGAATGCAGATCAGTTGTGGGAT
ACAACAATGAATCCTGAGCAAAGGACTCTCGTTAGAGTCTCTTTAAAGGA
TGCGGTCGAAGCAGACCATATCTTTACAATGTTAATGGGAGAAGAGGTAC
CTCCAAGACGTGAGTTCATTGAGAGTCACGCTTTATCCATTCGGATGAAT
AATTTAGATATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy