Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-1 IGR154 IGR156 IGR155 IGR153 IGR150 IGR152 IGR151 tdk, - CT188 CT181 dnaX,dnaZ, - CT187 gyrA, - CT189 devB,zwf,nagB, - CT186 zwf, - CT185 pyrG, - CT183 tdk, - CT188 CT181 dnaX,dnaZ, - CT187 gyrA, - CT189 devB,zwf,nagB, - CT186 zwf, - CT185 pyrG, - CT183 tdk, - CT188 CT181 dnaX,dnaZ, - CT187 gyrA, - CT189 devB,zwf,nagB, - CT186 zwf, - CT185 pyrG, - CT183 yqgF, - CT184 kdsB, - CT182 yqgF, - CT184 kdsB, - CT182
* Calculated from Protein Sequence

Gene ID: CT185

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
zwf  

Definition:
glucose-6-phosphate dehydrogenase

Gene Start:
206802

Gene Stop:
208118

Gene Length:
1317

Molecular Weight*:
51051

pI*:
5.17

Net Charge*:
-11.41

EC:
1.1.1.49  

Functional Class:
energy metabolism; pentose phosphate cycle  

Pathway: pathway table
Carbohydrate Metabolism; Pentose phosphate cycle

Comment:
This sequence is a perfect match to GenBank U83195 (C. trachomatis).
This enzyme mainly converts glucose-6-phosphate to 6-phosphoglucanolactone.
In some organisms it becomes additionally involved in glutathione metabolism.
See CT186.

From Prosite PDOC00067:

Glucose-6-phosphate dehydrogenase (EC 1.1.1.49) (G6PD) [1] catalyzes the first step in the pentose pathway, the reduction of glucose-6-phosphate to gluconolactone 6-phosphate. A lysine residue has been identified as a reactive nucleophile associated with the activity of the enzyme. The sequence around this lysine is totally conserved from bacterial to mammalian G6PD's and can be used as a signature pattern.
-Consensus pattern: D-H-Y-L-G-K-[EQK]
[K is the active site residue]

[ 1] Jeffery J., Persson B., Wood I., Bergman T., Jeffery R., Joernvall H. Eur. J. Biochem. 212:41-49(1993).

Blast Summary:  PSI-Blast Search
CT185 is orthologously related to CPn0238: residues 1-438 of CT185 are 72% similar to residues 73-511 of CPn0238, a predicted glucose-6-P dehyrogenase from C. pneumoniae.
CT185 is also similar to TP0478, a predicted glucose-6-phosphate 1-dehydrogenase from T. pallidum.
Many hits using gapped and Psi BLAST to glucose-6-phosphate dehydrogenases: best
matches (E scores) were to human and rat sequences, with exception of a perfect match
to GenBank U83195 from C. trachomatis. CT185 is similar to TP0478 of T. pallidum, a predicted
glucose-6-ph 1-dehydrogenase. No similarity however to M. genitalium.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0364
COG name: Glucose-6-phosphate 1-dehydrogenase
Functional Class:  G
The phylogenetic pattern of COG0364 is ----yqvcebRhuj--olin-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Strong matches to blocks BL00069A-G, concerned with G6PD sequences,
e.g. G6PD_ECOLI, G6PD_HAEIN.

ProDom Summary:  Protein Domain Search
Residues 13-278 are 43% similar to a G6PD domain as seen in G6PD_NOSS2.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 1 to 139 (E-value = 5.4e-18) place CT185 in the G6PD_N family which is described as Glucose-6-phosphate dehydrogenase, NAD binding domain (PF00479)
Residues 141 to 439 (E-value = 3.4e-124) place CT185 in the G6PD_C family which is described as Glucose-6-phosphate dehydrogenase, C-terminal domain (PF02781)

PDB Hit:
gi|1421566|pdb|1DPG|A Chain A, Glucose 6-Phosphate Dehydrogenase From Leuconostoc Mesenteroides Oxidoreductase, NadpNAD, GLUCOSE METABOLISM Mol_id: 1; Molecule: Glucose 6-Phosphate Dehydrogenase; Chain: A, B; Synonym: G6pd; Ec: 1.1.1.49; Engineered: Yes;

Gene Protein Sequence:
MKLAVQHFSHSSEIDIRVWESLENRIFYHQANFSDAEGYSVLKAYLEQLD
QQYGTQGNRLFYLSTPPDYFQEIIRNLNRHQLFYHEQGAQQPWSRLIIEK
PFGVNLETARELQQCIDANIDEESVYRIDHYLGKETVQNILTIRFANTLF
ESCWNSQYIDHVQISVSESIGIGSRGNFFEKSGMLRDMVQNHLTQLLCLL
TMEPPSEFFSEEIKKEKIKILKKILPIREEDAVRGQYGEGIVQDVSVLGY
REEENVDPNSSVETYVALKLFIDNPRWKGVPFYLQAGKRLPKRTTDIAVI
FKKSSYNLFNAENCPLCPLENDLLIIRIQPDEGVALQFNCKVPGTNKLVR
PVKMDFRYDSYFNTVTPEAYERLLCDCILGDRTLFTSNEEVLASWELFSP
LLEKWSQVRPIFPNYMAGSLRPQEADELLSRDGKAWRPY

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGCTTGCCGTTCAGCATTTCTCTCACTCATCGGAAATAGATATTCG
AGTTTGGGAAAGTCTGGAAAATAGAATCTTTTACCACCAAGCTAATTTTT
CTGATGCCGAAGGCTACTCTGTTCTGAAAGCTTATTTGGAGCAACTAGAT
CAACAATATGGAACACAAGGGAATCGTCTTTTTTATTTATCAACACCACC
AGATTATTTCCAGGAAATCATCCGCAATTTAAATCGGCATCAGCTATTCT
ATCATGAACAAGGAGCACAACAGCCTTGGTCTCGGCTAATTATAGAAAAG
CCTTTTGGAGTTAATTTAGAAACAGCTCGAGAGCTTCAACAATGCATTGA
TGCCAATATTGATGAAGAGTCGGTTTATCGAATAGACCATTATTTAGGAA
AAGAAACGGTTCAAAACATTCTGACTATTCGTTTTGCTAATACTCTCTTT
GAGTCTTGCTGGAATTCTCAGTACATAGATCATGTGCAAATCAGCGTTAG
CGAATCAATTGGTATAGGATCTCGAGGGAATTTCTTCGAAAAGTCGGGCA
TGCTACGAGACATGGTACAGAATCATTTGACGCAGCTGCTATGTCTACTG
ACTATGGAACCTCCTTCTGAATTTTTTTCCGAAGAAATAAAAAAAGAAAA
AATTAAAATTCTAAAGAAAATTCTTCCTATCCGCGAAGAAGATGCTGTTC
GTGGCCAGTATGGTGAAGGGATTGTGCAAGATGTTTCAGTTCTGGGCTAT
CGGGAGGAAGAAAATGTCGATCCGAATTCTTCAGTAGAAACCTACGTTGC
GTTAAAATTATTTATCGACAATCCTCGCTGGAAAGGGGTTCCCTTTTACT
TACAAGCAGGGAAACGTCTTCCTAAAAGAACAACAGATATCGCTGTGATC
TTTAAAAAATCCAGCTACAATTTATTCAATGCAGAGAATTGTCCTTTGTG
TCCGTTAGAGAATGATTTACTTATTATTCGTATTCAACCGGATGAAGGTG
TTGCGTTACAATTTAACTGCAAGGTTCCAGGAACAAATAAGCTCGTACGT
CCTGTAAAAATGGACTTCCGTTACGACAGCTATTTTAATACTGTTACTCC
CGAAGCTTATGAACGGTTACTGTGCGACTGTATCCTTGGGGACAGAACGC
TATTCACTAGCAATGAAGAAGTCTTAGCATCTTGGGAACTATTTTCTCCT
CTATTAGAAAAATGGTCTCAAGTACGCCCTATATTCCCTAACTATATGGC
TGGATCTTTACGTCCTCAAGAAGCTGATGAACTATTATCTAGAGATGGAA
AAGCTTGGCGGCCCTAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy