Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-1 tRNA-Ile-1 IGR148 IGR147 IGR146 IGR149 IGR150 IGR152 IGR151 nhaB?,dsbB?,roxB?, - CT176 CT179 tauB,nrtC, - CT180 CT181 dsbG?, - CT177 CT178 zwf, - CT185 CT175 pyrG, - CT183 nhaB?,dsbB?,roxB?, - CT176 CT179 tauB,nrtC, - CT180 CT181 dsbG?, - CT177 CT178 zwf, - CT185 CT175 pyrG, - CT183 nhaB?,dsbB?,roxB?, - CT176 CT179 tauB,nrtC, - CT180 CT181 dsbG?, - CT177 CT178 zwf, - CT185 CT175 pyrG, - CT183 yqgF, - CT184 kdsB, - CT182 yqgF, - CT184 kdsB, - CT182
* Calculated from Protein Sequence

Gene ID: CT180

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:


Gene Name:
tauB  nrtC  

Definition:
ABC transporter (exact function unknown)

Gene Start:
202303

Gene Stop:
201614

Gene Length:
690

Molecular Weight*:
25580

pI*:
6.78

Net Charge*:
-0.70

EC:
 

Functional Class:
transport and binding; general  

Pathway: pathway table
Membrane Transport; ATP-binding cassette (ABC) transport system

Comment:
Estimated fourteen proteins of C. trachomatis with ABC transporter
motif of which this is one. Similarities, however, are weak (appprox. 20%) outside the ATP binding domain. Possible Fe/nitrate transport protein.

For a recent review of ABC transporters, please see Nikaido and Hall. 1998. Overview of bacterial ABC transporters. Methods Enzymol 292:3-20. Medline: 9711542. See also, Linton and Higgins, 1998 (Medline: 9593292), Saier et al., 1998 (Medline: 9506471), and Fath and Kolter, 1993 (Medline: 8302219).

For a complete listing of Chlamydia ABC transporters, alignments of transporters, nucleotide binding domain organization,and plasma membrane organization, please go to: http://www.stdgen.lanl.gov, choose Bacteria under the Analysis heading on the left-side navigation frame, then click on the ABC transporters analysis subsection.

Blast Summary:  PSI-Blast Search
Numerous significant similarities to recognized transport proteins: e.g. residues 7-205 are 38% similar to a transporter protein from B.subtilis (AF008220). Similarity to sulfate and thiosulfate transport proteins in Synechocystis (P74548).

CT180 is orthologously related to CPn0231: residues 1-213 are 50% similar to CPn0231. CT180 is 30% similar to TP0164 of T. pallidum, a putative ATP-binding (troB) protein. Several similarities are to spermidine/putrescine ABC transporters. CT180 is similar to MG467, a predicted heterocyst maturation protein in M. genitalium.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1101
COG name: ATPase components of various transport systems
Functional Class:  E,P,G,R
The phylogenetic pattern of COG1101 is AmTKyQ-CEBRHUj----i--
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 29-44 are matched to block PR00364A, concerned with disease resistance factor, e.g. in A54809.

Residues 27-52 are also matched to block PR00193B, concerned with myosin heavy chain sequences. A more promising hit is of residues 15-57, 118-138, 148-168 to blocks BL00617A,E, concerned with recF sequences, e.g. RECF_LACLC.

Residues 29-44 show borderline match to block PR00441A, concerned with G-protein sequences.

ProDom Summary:  Protein Domain Search
Residues 126 to 197 are similar to P29_MYCPN, which appears to be involved in DNA repair in Mycoplasm; other members of this small group are YE70_HAEIN and RA50_YEAST.

Paralogs:  Local Blast Search
One of 14 or more proteins in C. trachomatis with well-defined ATP binding domain (ABC
transporters):

CT180 29262 28573 (ABC transporter (iron??) 455 e-130
CT653 578015 577299 ABC TRANSPORTER ATPase. 85 2e-18
CT130 1014409 1015107 ABC transporter ATPase 85 2e-18
CT068 950129 950944 ABC transporter ATPAse 79 1e-16
CT152 1733 2407 ABC TRANSPORTER ATPase 77 4e-16
CT202 53770 54510 (OPPF like ABC class ATPase) 70 5e-14
CT416 313421 314128 (ABC transporter ATPASE) 68 3e-13
CT264 123398 121461 (ABC transporter of the MsbA class) 62 2e-11
CT689 618689 617862 (ABC transporter ATPase) 57 4e-10
CT690 619647 618685 (ABC transporter ATPase ) 56 9e-10
CT201 52922 53752 (OPPD like ABC class ATPase) 53 7e-09
CT685 613730 614494 ABC transporter ATPASE) 43 1e-05
CT348 224293 225876 (ABC transporter ATPASE) 41 4e-05
CT333 202649 208006 ( EXCINUCLEASE ABC SUBUNIT A uvrA) 40 7e-05
CT128 1013561 1012827 ADENYLATE KINASE 36 0.001

Pfam Summary:  Pfam Search
Residues 27 to 205 (E-value = 2.6e-42) place CT180 in the ABC_tran family which is described as ABC transporter (PF00005)

PDB Hit:
None.

Gene Protein Sequence:
MLDVKSLYYSHASHSVFEDASASFASGQISMVLGASGSGKTTLFRIIAGL
LSCSLGEILWKGQPIQQEQIAYMQQKEALLPWRTVRKNILLLTELGSRKQ
KTTIEEECFYNVVHSFGLSSLLDRFPDELSGGQRQRVVFAMQSLSPKPIL
LLDEPFTSLDPITKEILYQDVKRLAKEEGKTIILASHDVQDCLGVGEAFF
AIQNQKLHSIALNKEQGIAGLLQQMKDHLV

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTAGACGTAAAATCTCTGTATTATTCTCATGCATCTCACTCTGTTTT
TGAAGATGCATCAGCTAGCTTTGCTTCTGGTCAGATTTCTATGGTTCTGG
GGGCTTCTGGAAGTGGTAAGACTACATTATTTAGGATCATAGCAGGTCTT
CTCTCTTGTTCTTTAGGAGAAATTCTCTGGAAAGGGCAACCTATACAGCA
GGAGCAGATAGCCTACATGCAGCAAAAGGAAGCTTTGTTACCCTGGCGCA
CCGTTAGAAAAAATATTTTATTGTTAACGGAGTTAGGATCGCGCAAACAG
AAAACAACTATTGAAGAAGAATGTTTCTACAATGTTGTGCATTCTTTCGG
GCTATCTTCATTGTTAGATCGATTTCCAGATGAATTATCTGGAGGACAGC
GTCAACGTGTTGTGTTTGCTATGCAAAGCTTATCTCCAAAGCCTATTTTG
CTGTTAGATGAGCCTTTCACGTCTTTGGATCCCATTACGAAAGAAATTTT
ATACCAAGATGTGAAAAGATTAGCCAAAGAAGAAGGAAAGACGATCATAC
TAGCTTCGCATGATGTGCAAGATTGTTTAGGAGTTGGGGAAGCCTTTTTC
GCGATCCAGAATCAGAAACTCCATTCAATTGCCTTAAATAAAGAACAAGG
AATCGCTGGGTTATTGCAGCAAATGAAGGACCACCTAGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy