Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR146 IGR140 IGR138 IGR139 IGR143 IGR144 IGR145 IGR142 IGR141 CT172.1 CT173 nhaB?,dsbB?,roxB?, - CT176 CT174 CT172 trpR, - CT169 CT168 CT165 trpB, - CT170 CT167 CT175 CT166 CT172.1 CT173 nhaB?,dsbB?,roxB?, - CT176 CT174 CT172 trpR, - CT169 CT168 CT165 trpB, - CT170 CT167 CT175 CT166 nhaB?,dsbB?,roxB?, - CT176 CT174 CT172 CT173 CT172.1 CT168 CT165 trpB, - CT170 CT167 CT175 CT166 trpA, - CT171 trpA, - CT171 trpR, - CT169
* Calculated from Protein Sequence

Gene ID: CT170

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:


Gene Name:
trpB  

Definition:
tryptophan synthase beta subunit

Gene Start:
192912

Gene Stop:
194087

Gene Length:
1176

Molecular Weight*:
42605

pI*:
7.25

Net Charge*:
1.77

EC:
4.2.1.20  

Functional Class:
amino acid biosynthesis; aromatic  

Pathway: pathway table
Amino Acid Metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis

Comment:
Trytophan synthase converts indole or 3-indolyl glycerol phosphate to
L-typtophan; it is a tetramer consisting of two alpha (See CT171) and
two beta chains. The trpR is CT169.
No similarity to C.pneumoniae.

Blast Summary:  PSI-Blast Search
Several significant matches are found using gapped BLAST, e.g., residues
7-385 are 55% similar to the tryptophan synthase beta subunit from Aquifex
aeolicus (AE000703). Other similarities involve TRPB_MYCTU (54%),
TRP2_MAIZE (50%), TRPB_THEMA (52%). No similarities to T.pallidum or M.genitalium.
No similarity to C.pneumoniae.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0133
COG name: Tryptophan synthase beta chain
Functional Class:  E
The phylogenetic pattern of COG0133 is amtkyqVcEbrhuj----i--
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Significant matches to blocks BL00168BB, C, D and E which
encompass the tryptophan synthase beta chain. Relevant
residues of CT170 appear to be 103-345.

ProDom Summary:  Protein Domain Search
Closest domain found in TRP_COPCI: 53% similarity over
residues 139-368. Residues 65-139 support this match as evidenced
by the similarity to TRPB_THEMA.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
Residues 46 to 375 (E-value = 3.5e-120) place CT170 in the PALP family which is described as Pyridoxal-phosphate dependent enzyme (PF00291)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
72  
140

PDB Hit:
gi|1421253|pdb|1TTP|B Chain B, Tryptophan Synthase (E.C.4.2.1.20) In The Presence Of Cesium, Room Temperature Mol_id: 1; Molecule: Tryptophan Synthase; Chain: A, B; Ec: 4.2.1.20; Engineered: Yes; Other_details: Structure In The Presence Of Cesium

Gene Protein Sequence:
MFKHKHPFGGAFLPEELLAPIQNLKAEWEILKTQQSFLSELDCILKNYAG
RQTPLTEVKNFARAIDGPRVFLKREDLLHTGAHKLNNALGQCLLAKYLGK
TRVVAETGAGQHGVATATACAYLGLDCVVYMGAKDVERQKPNVEKMRFLG
AEVVSVTKGSCGLKDAVNQALQDWATTHSFTHYCLGSALGPLPYPDIVRF
FQSVISAEVKEQIHAVAGRDPDILIACIGGGSNAIGFFHHFIPNPKVQLI
GVEGGGLGISSGKHAARFATGRPGVFHGFYSYLLQDDDGQVLQTHSISAG
LDYPSVGPDHAEMHESGRAFYTLATDEEALRAFFLLTRNEGIIPALESSH
ALAHLVSIAPSLPKEQIVIVNLSGRGDKDLPQIIRRNRGIYE

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCAAACATAAACATCCTTTTGGGGGAGCGTTCCTTCCCGAAGAACT
ATTAGCCCCTATACAGAATCTAAAAGCGGAATGGGAGATTCTCAAAACTC
AGCAAAGTTTTTTATCTGAACTAGATTGTATTTTGAAAAACTATGCGGGG
AGACAAACTCCTCTGACTGAAGTTAAGAATTTTGCTCGAGCTATTGATGG
CCCTAGAGTATTTCTTAAACGCGAAGATCTTTTGCATACAGGAGCACATA
AACTGAATAATGCTCTTGGTCAGTGTTTGCTTGCTAAATATCTTGGGAAA
ACACGTGTTGTAGCTGAAACAGGTGCGGGACAACATGGAGTAGCAACAGC
AACAGCGTGTGCTTATCTAGGATTAGATTGTGTAGTATACATGGGAGCAA
AAGATGTGGAACGACAGAAACCAAATGTAGAGAAAATGCGCTTTTTAGGT
GCTGAAGTCGTTTCTGTAACAAAAGGATCTTGTGGACTCAAAGATGCAGT
TAATCAAGCTCTACAAGATTGGGCAACAACACACTCATTTACTCACTATT
GCTTAGGATCGGCCTTAGGACCTTTACCTTATCCCGATATCGTTCGATTT
TTTCAGTCTGTTATAAGCGCTGAAGTGAAAGAGCAAATCCATGCAGTTGC
AGGAAGAGATCCTGATATTCTGATTGCATGTATCGGAGGTGGCTCCAACG
CTATTGGATTTTTCCATCATTTTATCCCGAATCCAAAAGTCCAATTAATT
GGAGTGGAAGGGGGAGGACTGGGCATTTCTTCAGGAAAACATGCAGCACG
TTTTGCAACAGGGCGACCTGGAGTATTCCACGGATTTTATTCGTATCTTC
TTCAAGATGACGATGGACAAGTATTACAAACTCACTCCATTTCCGCTGGA
TTAGATTATCCTTCAGTTGGGCCAGATCATGCCGAAATGCATGAGTCAGG
ACGAGCCTTTTATACATTAGCCACCGATGAAGAGGCGTTACGAGCTTTTT
TCCTGCTTACTAGAAACGAGGGGATTATTCCTGCATTGGAGTCTTCACAT
GCTCTCGCACATTTAGTTTCGATTGCTCCTTCTCTACCAAAGGAACAAAT
CGTCATCGTTAACTTATCTGGAAGAGGTGATAAGGATCTTCCACAAATCA
TCCGCAGAAACAGAGGAATTTATGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy