Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR136 IGR132 IGR131 IGR133 IGR134 IGR130 IGR135 CT162 CT156 CT160 CT161 CT159 CT154 CT157 CT153 CT164 CT163 CT162 CT156 CT160 CT161 CT159 CT154 CT157 CT153 CT164 CT163 CT162 CT160 CT161 CT159 CT154 CT157 CT153 CT158 CT155 CT158 CT155 CT156 CT164 CT163
* Calculated from Protein Sequence

Gene ID: CT158

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible phospholipase D protein)

Gene Start:
182792

Gene Stop:
182079

Gene Length:
714

Molecular Weight*:
26404

pI*:
9.63

Net Charge*:
8.21

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
In addition to paralogous relationships, similarity is observed to
U88070, a hypothetical protein from C.psittaci (28%).
No similarities to T. pallidum or M. genitalium.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1502
COG name: Cardiolipin synthase, phoaphatidylserine synthase and related enzymes of the phospholipase D family
Functional Class:  I
The phylogenetic pattern of COG1502 is a---y-vcEB-hUJ----INx
Number of proteins in this genome belonging to this COG is 7


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 13-44 and 86-221 are 29% and 36% similar to domains of
a transmembrane transferase as represented by YWIE_BACSU and CLS_ECOLI.

Paralogs:  Local Blast Search
This protein is paralogously related to four other CT proteins:
CT157, CT154, CT084, and CT155, all of which are
conserved hypothetical proteins. Scores range from 140 (CT157)
to 76 (CT155) with the match to itself receiving a score of 476.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
82  
137

PDB Hit:
None.

Gene Protein Sequence:
MQLQKFKATNQARLHCKNIVVDGSLVITGSANFSDAAFSRDTNLVAIIRN
PSLGQLVVSQQSGWITGGSQQIEYCSLYCHNHQGVDKVVKAVQSAVKTIR
VAMLVLSHKEVLHALHQAAQRGVEVTVLVNPHNKAIPFYALQDLNSKVKL
RDVVVEENALLHCKVGLIDTNLLITGSANWTVRGLQYNIEDLIFIHQPTP
SQLSAFFNLWEQAMSLSREVTAKKIKKSARAQHKYDDE

Gene Nucleotide Sequence:  Sequence Viewer
GTGCAATTGCAGAAATTCAAAGCTACTAACCAGGCGCGACTACACTGTAA
AAATATAGTAGTTGACGGAAGCCTAGTGATTACAGGCTCCGCGAATTTCT
CTGACGCCGCATTCTCTCGTGACACCAACCTAGTTGCTATCATCCGCAAT
CCATCTCTTGGCCAATTAGTAGTCTCCCAACAATCTGGCTGGATTACCGG
TGGCTCGCAGCAAATAGAATACTGTAGTCTATACTGCCACAATCATCAAG
GAGTTGATAAAGTTGTTAAAGCGGTACAATCTGCAGTAAAAACCATCCGC
GTTGCTATGCTTGTTCTCTCTCACAAAGAGGTCCTTCACGCTCTTCATCA
AGCGGCGCAGAGAGGGGTTGAAGTAACGGTGCTTGTCAACCCTCACAATA
AAGCCATTCCATTCTATGCCTTGCAAGATCTCAACTCAAAAGTCAAACTT
CGTGACGTGGTAGTGGAAGAGAATGCACTCCTCCATTGCAAAGTCGGTTT
AATCGATACCAACCTCCTTATCACAGGTTCTGCGAACTGGACTGTCCGAG
GTCTTCAATACAATATAGAAGACCTTATCTTCATCCATCAACCGACACCT
AGCCAGCTTTCTGCCTTCTTTAATTTGTGGGAACAAGCTATGTCCCTAAG
CCGCGAAGTCACAGCTAAAAAAATAAAAAAGTCAGCTCGTGCACAACATA
AATACGACGATGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy