Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR132 IGR131 IGR133 IGR134 IGR130 IGR135 CT162 CT156 CT160 CT161 CT159 CT154 CT157 CT153 CT163 CT162 CT156 CT160 CT161 CT159 CT154 CT157 CT153 CT163 CT162 CT160 CT161 CT159 CT154 CT157 CT153 CT158 CT155 CT158 CT155 CT156 CT163
* Calculated from Protein Sequence

Gene ID: CT157

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (basic)(possible phospholipase D HKD-related protein)

Gene Start:
181952

Gene Stop:
180741

Gene Length:
1212

Molecular Weight*:
45342

pI*:
10.44

Net Charge*:
17.66

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
See CT154, CT155, CT156, CT157, CT158 (proposed pld genes), CT084, and CT284.

Blast Summary:  PSI-Blast Search
A few hits in Psi-BLAST to poorly characterized proteins,
e.g., U88070, a C. psittaci hypothetical protein believed
to be involved in a type III secretion pathway. Residues 112-402
are 30% similar to this C.psittaci protein. Also,
residues 258-377 are 25% similar to a membrane bound
endonuclease in Helicobacter (AE000550). No similarities to T.pallidum
or M.genitalium.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1502
COG name: Cardiolipin synthase, phoaphatidylserine synthase and related enzymes of the phospholipase D family
Functional Class:  I
The phylogenetic pattern of COG1502 is a---y-vcEB-hUJ----INx
Number of proteins in this genome belonging to this COG is 7


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
CT157 is paralogously related to CT154, CT155, CT158, and CT084 (in
decreasing order of similarity), all thought to be members of the phospholipase D
superfamily:

CT157 8811 7600 phospholipase D endonuclease superfamily conse... 809 0.0
CT154 6330 5182 phospholipase D endonuclease superfamily conse... 203 6e-54
CT155 7240 6302 phospholipase D endonuclease superfamily conse... 147 6e-37
CT158 9651 8938 phospholipase D endonuclease superfamily conse... 140 8e-35
CT084 966999 965917 phospholipaseD/ nuclease family probably s... 126 1e-30

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
109
transmembrane  
139  
163

PDB Hit:
None

Gene Protein Sequence:
MSVQGSSSLKYSDLFKPPEPTSSTDSSKEPPKESAWKVVSHSRGRRRARS
NPSPHTSQNTPSPKDSSLVARTDKAATDIFNSAKHKAIETTKRSDQQSRS
LHILHLLAENPEPIVFHSAHQTNHNDPQRMLCDAILQANRIITMRIFNIG
SPEIIRALIRAVRRNIPVVVSAWNFPNLSNWDRESELCVELRGNPQICLH
KKTTLIDNQLTIIGTANYTKSSFFKDINLTALIQNPALYSLILSDTRGSV
SIGSQTISYYPLPFPQSNTKILPIIQEIQKAQRTIKIAMNIFSHTEIFLA
LEQARLRGVTITIVINKKESAHTLDILHRISALLLLKSVTTVDSLHAKIC
LIDNQTLIFGSPNWTYHGMHKNLEDLLIVTPLTPKQIHSIQEIWAFLLKN
SSPV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGTACAAGGCTCTTCTTCTTTAAAATACAGCGATCTTTTTAAACC
TCCGGAACCCACTTCTTCCACAGATTCTTCTAAAGAACCTCCTAAAGAAT
CTGCATGGAAAGTAGTCTCTCATTCTCGAGGACGCCGTCGCGCTCGATCC
AACCCCTCCCCTCACACATCTCAAAATACTCCTTCTCCAAAAGACTCTTC
TTTAGTTGCTCGTACGGATAAAGCGGCAACAGATATCTTTAATTCGGCTA
AACACAAAGCGATTGAAACGACAAAAAGAAGTGATCAGCAAAGCAGATCC
TTACATATACTGCACCTTTTAGCTGAAAATCCGGAACCCATTGTGTTCCA
CTCAGCTCACCAAACAAACCACAACGATCCGCAAAGAATGCTATGCGATG
CCATCCTACAGGCTAACCGAATAATCACAATGAGAATTTTTAATATTGGT
TCTCCTGAAATTATTCGGGCATTAATTCGAGCCGTTCGTCGCAACATTCC
GGTTGTTGTTTCAGCATGGAATTTTCCTAATCTATCCAATTGGGATCGGG
AATCTGAACTCTGTGTGGAATTGAGAGGCAATCCTCAAATTTGCTTACAT
AAGAAAACGACACTGATTGACAATCAGCTAACAATTATAGGAACGGCTAA
CTACACTAAATCTTCTTTCTTTAAAGACATCAACCTAACAGCTCTTATTC
AAAACCCGGCGCTATATTCTTTAATTTTGAGCGATACTCGAGGCTCAGTT
TCTATCGGCTCGCAAACCATTTCCTATTACCCACTTCCCTTTCCTCAATC
CAATACTAAGATCTTGCCTATCATCCAAGAGATTCAAAAAGCTCAGAGAA
CTATAAAAATTGCTATGAATATCTTCTCTCATACCGAGATCTTTTTAGCC
TTAGAACAAGCACGCTTACGAGGAGTAACCATTACTATCGTAATCAATAA
AAAAGAGAGCGCCCATACACTAGACATATTACACAGAATCTCAGCTCTAC
TACTGTTAAAATCTGTTACAACAGTAGATTCTTTGCATGCAAAAATCTGT
TTAATCGATAATCAAACTCTGATTTTTGGCTCACCAAACTGGACTTACCA
TGGGATGCATAAAAATCTTGAAGACTTGCTCATAGTGACTCCACTCACAC
CCAAACAAATCCATTCAATTCAAGAAATATGGGCCTTTTTATTAAAAAAT
AGCTCTCCTGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy