Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR132 IGR131 IGR133 IGR134 IGR129 IGR130 CT162 CT156 CT160 CT161 CT159 CT154 CT157 CT153 ycfV, - CT152 CT162 CT156 CT160 CT161 CT159 CT154 CT157 CT153 ycfV, - CT152 CT160 CT161 CT159 CT154 CT157 CT153 CT158 CT155 CT158 CT155 CT156 CT162 ycfV, - CT152
* Calculated from Protein Sequence

Gene ID: CT156

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein (basic)

Gene Start:
180602

Gene Stop:
180264

Gene Length:
339

Molecular Weight*:
12932

pI*:
9.36

Net Charge*:
2.90

EC:
 

Functional Class:
hypothetical  

Pathway: pathway table

Comment:
Accession AE001289.
No similarity to C. pneumoniae.

Blast Summary:  PSI-Blast Search
None, but residues 3-78 are 25% similar to a membrane bound endonuclease from H. pylori (AE000550) (E value 5.4).

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
56  
113

PDB Hit:
None.

Gene Protein Sequence:
MNTIMEGIDNLFASIRTLAPTLRHRATSLLLKTVAPLLRNTNRENREFHH
HDQDRTIEVLPLNPLPLQYPSPSKCSPDPRENTRLPKTLLLPPLNEPDLL
RAKSYLDSYSITN

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATACGATCATGGAAGGAATAGACAACCTGTTCGCGTCTATACGAAC
CCTCGCTCCCACTCTACGTCATCGCGCAACATCTCTTCTCCTGAAGACCG
TCGCCCCACTCCTTCGCAATACAAATCGCGAGAATAGAGAATTCCATCAT
CACGACCAAGACAGGACGATAGAAGTCCTTCCCCTCAACCCTCTACCTCT
TCAGTATCCATCTCCCAGCAAATGCTCGCCGGATCCAAGAGAAAACACAA
GACTCCCGAAGACACTTCTTCTTCCTCCTCTAAACGAGCCCGATCTTCTT
CGAGCCAAGTCGTACCTAGACTCTTACAGCATCACGAAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy