Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR132 IGR131 IGR133 IGR129 IGR130 CT156 CT160 CT161 CT159 CT154 CT157 CT153 ycfV, - CT152 CT156 CT160 CT161 CT159 CT154 CT157 CT153 ycfV, - CT152 CT160 CT161 CT159 CT154 CT157 CT153 CT158 CT155 CT158 CT155 CT156 ycfV, - CT152
* Calculated from Protein Sequence

Gene ID: CT155

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (basic)(possible phospholipase D HKD-related protein)

Gene Start:
180381

Gene Stop:
179443

Gene Length:
939

Molecular Weight*:
35441

pI*:
9.35

Net Charge*:
11.52

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
May be a member of the phospholipase D superfamily. See CT154, CT157, CT158 (proposed pld genes), CT284, and CT084.

Blast Summary:  PSI-Blast Search
No significant hit in gapped BLAST suggestive of orthologs. Residues 48-285
are 25% similar to a hypothetical protein from C.psittaci (U88070)
postulated to be part of a type III secretion pathway (see Hsia et al., Mol.
Microbiol. 25:351, 1997). No similarities to T.pallidum
or M.genitalium.

CT155 is similar to CPn0329, a predicted Phopholipase D Superfamily protein: residues
23-280 are 24% similar to CPn0329.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1502
COG name: Cardiolipin synthase, phoaphatidylserine synthase and related enzymes of the phospholipase D family
Functional Class:  I
The phylogenetic pattern of COG1502 is a---y-vcEB-hUJ----INx
Number of proteins in this genome belonging to this COG is 7


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Paralogous relationships exist with CT154, CT157, CT084, and CT084
(in decreasing order of similarity), all of which are thought to be
members of the phospholipase D superfamily

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MLAGSKRKHKTPEDTSSSSSKRARSSSSQVVPRLLQHHELIQLYSAHQQR
NNEPVKMICETILQAKRSVLLKIFNIGSPRILAALAEASNRAPVSVHYQM
GPFSKHCTEGNVQFRPRRGCSLLHRKTLLIDNNIVVTGTANYTEASLEKD
VNLTAKIFSEHLYRWAFRHDRGEVRVGSQQVSYYSLSQIRRDLCVKAILE
ANGIVLRERTCEGILHTKVCCIDSSTLIIGSVNWSRGGLTLNLEEFLIIN
PLTETQLECYNELWAHIETNSRLMTKELIQLHEKRKKSITDPKQISSSTQ
DEENASTSAEQQF

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCGCCGGATCCAAGAGAAAACACAAGACTCCCGAAGACACTTCTTC
TTCCTCCTCTAAACGAGCCCGATCTTCTTCGAGCCAAGTCGTACCTAGAC
TCTTACAGCATCACGAACTGATCCAACTCTACTCTGCTCATCAGCAAAGA
AATAACGAACCTGTGAAAATGATTTGTGAAACAATTCTACAAGCTAAGCG
CAGCGTTCTATTAAAAATATTTAATATCGGATCCCCCAGAATTCTTGCAG
CCTTAGCTGAGGCTTCTAATAGAGCGCCTGTCTCCGTACACTATCAAATG
GGGCCTTTTTCAAAACACTGTACTGAAGGAAATGTGCAGTTTAGACCTCG
AAGAGGGTGTTCTCTTTTACATAGAAAAACCCTTCTTATAGACAATAATA
TTGTCGTTACGGGAACAGCAAACTATACAGAGGCCTCTCTTGAAAAAGAT
GTGAACTTAACGGCTAAAATATTTAGCGAACACCTATATCGCTGGGCTTT
CCGACACGATCGAGGAGAGGTGCGAGTAGGCTCGCAACAAGTATCCTACT
ATTCGCTAAGTCAAATACGAAGAGACTTGTGCGTCAAAGCTATCCTCGAA
GCTAACGGCATTGTCCTACGAGAACGTACATGCGAAGGCATTCTGCATAC
CAAAGTCTGCTGTATTGATAGCTCGACACTCATTATAGGATCCGTCAACT
GGAGTAGAGGAGGTCTTACATTAAATCTGGAAGAGTTCTTGATTATCAAT
CCGCTTACAGAGACACAACTCGAATGCTATAACGAGCTTTGGGCACATAT
AGAAACAAACAGTAGATTGATGACTAAAGAGCTGATTCAGTTACATGAGA
AGAGAAAAAAATCCATAACAGACCCTAAGCAAATCTCTTCTTCTACTCAA
GACGAAGAGAATGCTTCCACATCAGCAGAACAGCAGTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy