Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR120 IGR119 IGR122 IGR123 IGR121 CT143 CT144 CT142 pkn1, - CT145 dnlJ, - CT146 CT147 CT143 CT144 CT142 pkn1, - CT145 dnlJ, - CT146 CT147 CT144 CT142 pkn1, - CT145 dnlJ, - CT146 CT147 CT143
* Calculated from Protein Sequence

Gene ID: CT146

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnlJ  

Definition:
DNA ligase (NAD dependent)

Gene Start:
163592

Gene Stop:
165580

Gene Length:
1989

Molecular Weight*:
73497

pI*:
6.61

Net Charge*:
-2.27

EC:
6.5.1.2  

Functional Class:
DNA replication and repair  

Pathway: pathway table

Comment:
Responsible for phosphodiester linkages in double-stranded DNA.



Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to DNA ligase (NAD dependent) proteins, e.g., 37% similarity to DNLJ_ECOLI, 39% similarity to DNLJ_THETH.
CT146 is similar to TP0634 in T.pallidum and to MG254 in M.genitalium, both
predicted DNA ligases.

CT146 is orthologously related to CPn0149: residues 5-657 are 60% similar to CPn0149.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0272
COG name: NAD-dependent DNA ligase (contains BRCT domain type II)
Functional Class:  L
The phylogenetic pattern of COG0272 is -----qvcEbrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 11-52, 112-151, 194-216, 272-305, 317-356, 357-382 are significantly matched to blocks BL01055A,B,C,D,E,F, concerned with NAD-dependent DNA ligase proteins, e.g., DNLJ_ECOLI.
Residues 397-413 are significantly matched to blocks PR00493A, concerned with breast cancer type I susceptibility proteins, e.g., MMU31625.

ProDom Summary:  Protein Domain Search
Residues 112-385 are 42% similar to a polydeoxyribonucleotide synthase domain as observed in DNLJ_ECOLI. Residues 19-104, 389-573 and 583-654 are consistent with this observation.


Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 3 to 313 (E-value = 4.5e-102) place CT146 in the DNA_ligase_aden family which is described as NAD-dependent DNA ligase adenylation domain (PF01653)
Residues 315 to 397 (E-value = 2e-49) place CT146 in the DNA_ligase_OB family which is described as NAD-dependent DNA ligase OB-fold domain (PF03120)
Residues 401 to 426 (E-value = 1.9e-08) place CT146 in the DNA_ligase_ZBD family which is described as NAD-dependent DNA ligase C4 zinc finger domain (PF03119)
Residues 526 to 555 (E-value = 2.5e-08) place CT146 in the HHH family which is described as Helix-hairpin-helix motif (PF00633)
Residues 581 to 657 (E-value = 2.5e-19) place CT146 in the BRCT family which is described as BRCA1 C Terminus (BRCT) domain (PF00533)

PDB Hit:
none

Gene Protein Sequence:
MGAVSRDDYIALCTELVEHDRRYYVLNQPTISDYSYDVKMRELQEIEVQH
PEWKVSWSPTMYLGDRPSGQFPVVPHSSPMLSIANVYSLQELEEFFSRTE
KLLGYSPGYSLELKIDGIAVAIRYEKRLFAQALSRGNGVKGEDITANVST
IRSLPMRLPQEAPEDLEVRGEVFLSYEAFEELNACQREQGKLEFANPRNA
AGGTLKLLSSKEAAKRKLDLSVYGLITDQKKRSHFENLQLCSQWGFFVAG
MPKQCRSRQDVVERIREIEEMRAALPMAIDGVVIKVDNIAYQDRLGLTSK
HYRWAIAYKYAPERAETILEDIVVQVGKTGILTPVAELAPVFLSGSRVSR
ASLYNQDEIEKKDIRIGDSVYVEKGGEVIPKIVGINLAKRSLESEPWKMP
SLCPVCHEPVVKEKVSVRCVNPLCSGGMLEKICFFASKSALNIDHLGEKV
VTKLFEVGLISSCSDIFALAEEDLKQVPGFKDRSIQNLLASIAGAKKVAL
DRLLTALSIPFVGSSGAIALADHFGTLDKVIEASLDELMSIEGIGPKVAA
SIVAFFSKHENREEIRRMQELGVQVLSKQSDKEAPLQGKVFVLTGTLQQM
TRTQAEERIRCLGGKVSSSVSKSTYAVIAGSEAGGKLKKAQDLGLSIWNE
SELLRILDAKSVS

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTGCTGTATCTCGAGATGATTATATTGCTTTATGCACAGAATTAGT
GGAACATGACCGACGCTATTATGTGCTCAATCAACCGACGATTTCTGATT
ACAGCTATGATGTGAAAATGCGAGAGCTTCAAGAAATAGAAGTTCAGCAT
CCGGAATGGAAGGTTTCATGGTCTCCTACCATGTATTTGGGGGATCGTCC
TTCAGGACAGTTTCCTGTGGTTCCTCATTCTAGCCCCATGTTGTCTATAG
CGAATGTATACTCATTGCAAGAGCTAGAGGAATTTTTTTCCCGTACAGAA
AAATTATTGGGGTACTCTCCTGGATATTCTTTAGAACTCAAAATTGATGG
AATTGCTGTCGCCATTCGGTACGAGAAGCGATTGTTTGCTCAAGCTTTGA
GTCGGGGGAATGGGGTAAAAGGAGAAGATATTACAGCTAATGTCAGTACT
ATACGCTCTTTACCTATGAGACTCCCTCAAGAGGCTCCCGAGGATCTAGA
AGTGCGAGGAGAAGTGTTTCTTTCATATGAAGCGTTTGAAGAGCTCAATG
CTTGTCAACGGGAACAAGGGAAACTGGAATTTGCTAATCCTCGTAATGCA
GCTGGAGGAACTCTTAAGCTTTTATCTTCTAAGGAAGCTGCTAAGCGTAA
ATTAGACTTGTCTGTTTATGGGTTGATCACAGATCAAAAAAAACGCTCAC
ATTTTGAAAATCTTCAGTTATGCTCTCAATGGGGATTTTTCGTTGCAGGG
ATGCCGAAACAATGCCGTTCGAGACAAGATGTGGTAGAACGTATTCGAGA
GATAGAGGAGATGCGCGCAGCGCTCCCGATGGCTATCGATGGAGTCGTCA
TTAAAGTAGACAATATTGCATACCAGGATCGGCTAGGTTTGACGAGCAAA
CATTATCGTTGGGCGATAGCTTATAAATATGCTCCGGAAAGAGCAGAAAC
GATTTTGGAGGATATTGTCGTTCAAGTAGGGAAAACGGGTATTCTTACTC
CGGTTGCCGAGTTAGCTCCTGTTTTTTTATCTGGGAGCCGCGTGTCCAGA
GCATCCTTATACAACCAAGATGAGATTGAAAAAAAAGATATTCGCATCGG
AGATTCGGTGTATGTCGAAAAAGGAGGAGAGGTTATTCCCAAAATTGTTG
GGATTAATTTGGCTAAGCGTTCATTAGAGAGCGAGCCTTGGAAAATGCCA
AGCCTGTGTCCTGTATGTCATGAACCTGTTGTTAAAGAGAAGGTGTCGGT
GCGTTGTGTCAATCCACTTTGTTCAGGGGGGATGCTAGAAAAGATCTGTT
TCTTTGCAAGTAAGAGCGCTTTAAACATAGATCATTTGGGAGAGAAGGTC
GTAACTAAATTATTCGAAGTAGGTCTCATTAGTTCTTGTTCGGATATATT
TGCTCTTGCAGAAGAAGATTTGAAACAGGTCCCTGGGTTTAAAGATCGTT
CTATACAGAATTTATTGGCAAGCATTGCCGGAGCCAAAAAGGTGGCATTA
GATCGGCTTTTAACGGCTCTTTCTATTCCTTTTGTGGGGAGCTCTGGTGC
CATAGCTTTGGCAGACCACTTCGGAACTCTGGACAAAGTAATCGAAGCTT
CTTTAGATGAGCTGATGTCTATAGAGGGGATTGGTCCTAAGGTAGCTGCA
TCGATCGTCGCGTTCTTCTCGAAACATGAGAATAGAGAGGAAATTCGTCG
GATGCAAGAGCTAGGAGTTCAGGTTCTTTCTAAGCAATCCGATAAAGAGG
CTCCTTTACAAGGAAAAGTGTTTGTTCTTACGGGGACTCTCCAACAGATG
ACGAGAACGCAAGCAGAGGAGCGTATCCGCTGCCTAGGGGGGAAAGTGAG
CTCTTCGGTATCGAAGAGCACATATGCCGTCATAGCAGGTAGCGAAGCTG
GGGGTAAATTGAAAAAAGCTCAAGATTTAGGTTTAAGTATTTGGAACGAG
AGCGAATTATTAAGAATTCTTGATGCAAAATCGGTCTCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy