Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Thr-1 tRNA-Tyr-1 IGR120 IGR119 IGR122 IGR123 IGR117 IGR121 IGR118 CT141 ypdP, - CT140 CT143 CT144 CT142 pkn1, - CT145 dnlJ, - CT146 CT147 CT141 ypdP, - CT140 CT143 CT144 CT142 pkn1, - CT145 dnlJ, - CT146 CT147 CT141 ypdP, - CT140 CT143 CT144 CT142 pkn1, - CT145 dnlJ, - CT146 CT147
* Calculated from Protein Sequence

Gene ID: CT145

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pkn1  

Definition:
probable serine/threonine kinase

Gene Start:
161737

Gene Stop:
163578

Gene Length:
1842

Molecular Weight*:
69685

pI*:
4.91

Net Charge*:
-26.62

EC:
2.7.-.-  

Functional Class:
translation; protein modification  

Pathway: pathway table

Comment:
See CT673 and CT301. This gene tentatively designated pknI.
See CPn0148.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to protein kinase sequences: typically
N-terminal residues were similar to the SNF-1 protein
kinase of C. sativus and the enzyme from Arabidopsis.
N-terminal residues were similar to YfmG_BACSU and Z84395,
of unknown function in M. tuberculosis. Residues 36-313 are 22% similar
to MG109, a predicted serine/threonine kinase. No similarity to T.pallidum.
CT145 and CPn0148 are orthologously related: residues 2-613 are 58% similar to CPn0148.

COGS Summary:  COGS Search
BeTs to 4 clades of COG0515
COG name: Serine/threonine protein kinases
Functional Class: T
The phylogenetic pattern of COG0515 is amtkYq-C-BR---gp-lIN-
Number of proteins in this genome belonging to this COG is 3


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 68-223 are 26% similar to a protein kinase domain
as seen in MSK_MOUSE.

Paralogs:  Local Blast Search
CT145 is weakly paralogous to CT673 and CT301, also thought to
be S/T kinases: residues 52-236 are 22% similar to CT673
and residues 25-235 are 20% similar to CT301.

Pfam Summary:  Pfam Search
Residues 13 to 263 (E-value = 1.8e-07) place CT145 in the Pkinase family which is described as Protein kinase domain (PF00069)
Residues 376 to 611 (E-value = 1.5e-102) place CT145 in the DUF323 family which is described as Domain of unknown function (DUF323) (PF03781)

PDB Hit:
gi|3114436|pdb|1A06| Calmodulin-Dependent Protein Kinase From Rat Kinase, Signal Transduction, CalciumCALMODULIN Mol_id: 1; Molecule: CalciumCALMODULIN-Dependent Protein Kinase; Chain: Null; Ec: 2.7.1.123; Engineered: Yes

Gene Protein Sequence:
MEERAAVEYWGDYKVIAELGHGLWSRDVLAEHRFIKKRYILKILPSELSS
SENFMRVFQEVIVQLAAIRHASLVAIENVSREGDRYFVVTEENGGTISLA
QYLSGRKLSEEEVVHLIQQLCDALELVHSIGLAHGQIHLHSVHVSFFNGI
ANIYLPEVGFASLLRERMFSTIMQSGSARESITRIRDLLMFEAPEEQEVF
GREADVYSVGVLAYYLLVGSFPWGSFPKPSLCMPDSWYDWDGFILSCLQQ
QREVRPKCLREALRRKTSGEQLQVTLDSCREPLREMEIEDTPTELGPPSA
LIREGERLCEVKEEQHAFVLVEAKSIDEVMVTTVDSEEELESSEGYANPL
QSLLAREPVVSRYVEVEREEIKPQPLLTEMIFIEGGEFSRGSGDGQRDEL
PVHNITLPGFFLDIHPVTNEQFVRFLECVGSEQDEHYNELIRLKDSRIQR
RSGRLIIEPGYAKHPVVGVTWYGASSYACWIGKRLPSEAEWEVAASGGKL
GLRYPTGEEIDKSKANFFSSDTTPVMSYPSSILGLYDMAGNVYEWCQDWY
SYDFYESSALEPDAPLGPPQGVYRVLRGGCWKSLKDDLRCAHRHRNNPGA
INSTYGFRCAKDVK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAGAGCGAGCCGCAGTTGAATATTGGGGAGACTACAAAGTAATCGC
AGAACTCGGACATGGATTGTGGAGCCGAGATGTGCTTGCGGAACATCGAT
TCATTAAAAAGCGTTATATTCTCAAGATACTGCCTTCGGAACTTTCCTCT
TCAGAAAATTTTATGCGAGTTTTTCAGGAAGTGATTGTTCAATTGGCTGC
CATTCGTCATGCAAGCTTGGTGGCTATCGAAAATGTGTCGCGAGAAGGGG
ATCGGTATTTTGTTGTTACTGAAGAAAATGGAGGGACTATTTCTCTTGCG
CAGTATTTGTCTGGAAGGAAACTGTCTGAAGAAGAAGTAGTGCATTTGAT
TCAGCAACTGTGCGATGCACTAGAGCTTGTGCATAGTATTGGGTTAGCCC
ATGGTCAGATTCATTTACATTCGGTACACGTTTCTTTCTTTAATGGGATA
GCTAATATCTATCTTCCAGAAGTCGGCTTTGCTTCTTTGCTCAGAGAACG
CATGTTTTCCACCATCATGCAGTCTGGATCAGCGCGAGAGAGTATTACAC
GTATTCGTGACTTGTTGATGTTTGAGGCTCCTGAAGAACAAGAGGTCTTT
GGTCGAGAGGCCGATGTTTACTCCGTTGGTGTATTAGCTTATTATTTATT
AGTAGGATCTTTTCCTTGGGGATCTTTCCCCAAGCCTTCGCTTTGCATGC
CTGATAGCTGGTATGATTGGGATGGGTTTATCTTAAGTTGTTTACAACAA
CAACGGGAGGTTCGCCCTAAATGTTTACGAGAGGCTTTAAGGAGAAAGAC
GTCAGGAGAACAGCTGCAGGTTACGCTTGACAGCTGTCGCGAGCCTCTAC
GTGAAATGGAAATAGAAGACACTCCTACAGAGTTGGGACCCCCTTCCGCT
CTTATTCGGGAAGGAGAAAGGCTGTGTGAAGTTAAGGAAGAGCAGCATGC
TTTTGTATTAGTAGAGGCCAAGTCGATCGATGAGGTGATGGTTACCACTG
TAGATTCAGAGGAAGAGCTTGAGAGTAGCGAGGGATATGCGAACCCTCTT
CAATCCCTGTTAGCAAGGGAGCCTGTAGTGAGTCGCTATGTAGAAGTGGA
AAGAGAAGAGATTAAGCCGCAACCATTATTGACGGAAATGATCTTCATTG
AGGGAGGGGAGTTCTCTCGAGGAAGTGGGGATGGTCAACGAGATGAGTTG
CCTGTACACAATATTACTTTACCAGGGTTTTTCTTGGACATTCATCCTGT
TACCAATGAGCAGTTTGTCCGGTTTTTAGAATGCGTAGGAAGTGAGCAAG
ACGAACACTACAATGAGCTCATTCGTTTGAAAGATTCGAGAATTCAACGT
CGATCAGGCCGACTGATCATTGAGCCAGGGTATGCTAAGCATCCTGTTGT
AGGAGTAACTTGGTATGGAGCTTCTTCTTATGCTTGTTGGATAGGTAAGC
GGTTGCCTTCAGAAGCTGAATGGGAGGTAGCAGCCTCAGGAGGAAAGCTA
GGGTTGCGGTACCCTACCGGGGAAGAAATAGATAAAAGCAAAGCAAATTT
CTTTAGTTCGGATACTACTCCAGTTATGAGCTATCCTTCTAGTATACTGG
GTCTTTATGATATGGCTGGCAATGTGTATGAATGGTGCCAAGACTGGTAT
AGTTATGATTTTTATGAGAGTTCTGCTTTAGAGCCAGATGCTCCTTTAGG
GCCTCCTCAAGGGGTCTACCGTGTGTTGCGAGGAGGATGTTGGAAAAGTC
TAAAAGATGATCTACGTTGTGCACATCGCCATCGAAATAATCCTGGGGCT
ATTAACAGTACCTACGGGTTTCGTTGTGCGAAAGATGTAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy