Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Thr-1 tRNA-Tyr-1 IGR115 IGR119 IGR114 IGR112 IGR110 IGR113 IGR116 IGR117 IGR118 IGR111 CT133 oppA, - CT139 CT134 CT141 ypdP, - CT140 CT136 CT143 CT142 CT138 CT135 CT133 oppA, - CT139 CT134 CT141 ypdP, - CT140 CT136 CT143 CT142 CT138 CT135 CT133 oppA, - CT139 CT134 CT141 ypdP, - CT140 CT136 CT143 CT142 CT138 CT135 CT137 CT137
* Calculated from Protein Sequence

Gene ID: CT138

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (probable dipeptidase) (acidic)

Gene Start:
154876

Gene Stop:
155820

Gene Length:
945

Molecular Weight*:
35132

pI*:
4.90

Net Charge*:
-16.04

EC:
3.4.13.19  

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to hypothetical protein and dipeptidase proteins, e.g., 24% similarity to a membrane dipeptidase in Acinetobacter calcoaceticus, pir||JC4222, 22% similarity to YPQR_ACICA.
No similarities to T.pallidum or M.genitalium.

CT138 is orthologously related to CPn0269: residues 1-306 of CT138 are 54%
similar to residues 1-315 of CPn0269, a conserved hypothetical protein,
probable dipeptidase, from C. pneumoniae.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None

ProDom Summary:  Protein Domain Search
Residues 119 to 253 are 33% similar to a dehydropeptidase-I domain as seen in YPQQ_KLEPN.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
288  
315

PDB Hit:
None.

Gene Protein Sequence:
MIVDMHCDMLSHKNFSSSDPAVRSSPDQLIEGGVGLQACALFTESQECTT
LDEQNQLFFSLIEQDERLTPLSYEPQVESSLQVVRSIENASGLGSDAQPL
QELFHKLLLLHEQGPLAYIGLVWNFANRFGGGILEPKRLSRDGKNLLELL
HALAIPVDLSHCSDPLADDILDFTADKMPDMFVLASHSNFRAVQDIERNL
LDVHAKEIFARDGVIGLNGVNYFVGASLEDIKKHIAHAQELGILDSLVLG
TDFFYTEEEKFFPNFSTAKDHPKLHALIKEAIPIDKAQSLLEERAQRFLN
RVVSAQKKVVNHIAF

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAGTGGATATGCATTGTGATATGCTATCTCATAAAAACTTTTCCTC
TTCAGACCCAGCGGTACGAAGCTCTCCTGATCAATTAATAGAGGGTGGAG
TGGGATTGCAGGCCTGCGCCTTATTCACAGAATCACAAGAATGCACCACA
TTAGATGAACAAAACCAATTGTTCTTTTCTTTAATAGAGCAAGATGAGCG
ACTGACTCCACTATCTTACGAACCACAAGTAGAAAGCTCTTTGCAGGTAG
TTCGTAGTATTGAAAATGCTTCAGGTCTTGGCTCTGATGCTCAGCCTTTA
CAAGAACTATTTCACAAGCTTTTGTTGTTACATGAACAGGGCCCCTTAGC
CTATATAGGGCTTGTTTGGAATTTTGCAAATCGTTTTGGTGGTGGGATTT
TAGAGCCTAAACGTTTGTCCAGAGATGGGAAAAATCTTTTGGAATTGTTG
CATGCTCTAGCTATTCCAGTGGATCTTAGTCACTGCTCAGATCCTTTAGC
GGATGATATTTTAGATTTTACTGCGGATAAAATGCCGGACATGTTCGTAT
TGGCTAGTCACTCCAATTTTCGCGCGGTTCAGGATATCGAGCGGAACTTA
TTAGATGTGCATGCTAAAGAGATTTTTGCAAGGGATGGGGTGATTGGGCT
GAATGGAGTGAACTATTTTGTAGGAGCATCTTTGGAGGATATTAAAAAGC
ATATCGCTCATGCCCAAGAGTTAGGGATTTTAGATAGTTTAGTATTAGGA
ACAGACTTTTTTTATACTGAGGAAGAAAAGTTTTTCCCTAATTTTTCCAC
AGCAAAAGATCACCCTAAACTACACGCTTTGATTAAGGAGGCTATTCCTA
TAGACAAGGCGCAATCTCTGCTAGAGGAAAGAGCTCAGCGATTTTTGAAT
CGGGTAGTTTCGGCACAAAAGAAAGTTGTCAATCACATTGCGTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy