Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Thr-1 IGR115 IGR114 IGR112 IGR110 IGR113 IGR116 IGR117 IGR118 IGR111 CT133 CT132 oppA, - CT139 CT131 CT134 CT141 ypdP, - CT140 CT136 CT138 CT135 CT133 CT132 oppA, - CT139 CT131 CT134 CT141 ypdP, - CT140 CT136 CT138 CT135 CT133 CT132 oppA, - CT139 CT131 CT134 CT141 ypdP, - CT140 CT136 CT138 CT135 CT137 CT137
* Calculated from Protein Sequence

Gene ID: CT136

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
probable serine esterase

Gene Start:
153315

Gene Stop:
154031

Gene Length:
717

Molecular Weight*:
26835

pI*:
5.37

Net Charge*:
-7.35

EC:
3.1.1.1  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table

Comment:
Thought to be an esterase of the lysophospholipase group.

Blast Summary:  PSI-Blast Search
Three hits in gapped BLAST, two to serine esterases, one to a probable membrane protein from yeast. Residues
26-233 are 24% similar to a serine esterase from Synechocystis (D90904). No similarities to
T.pallidum or M.genitalium.

CT136 is similar to CPn0271, a predicted Lysophospholipase esterase: residues 3-235 are 53% similar to CPn0271.

COGS Summary:  COGS Search
BeTs to 4 clades of COG0400
COG name: Carboxylesterases
Functional Class:  R
The phylogenetic pattern of COG0400 is ----y--ce---------inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None

ProDom Summary:  Protein Domain Search
None

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 11 to 236 (E-value = 2e-103) place CT136 in the Abhydrolase_2 family which is described as Phospholipase/Carboxylesterase (PF02230)

PDB Hit:
none

Gene Protein Sequence:
MSYSFFRRKLAGIEFIECPGDPEAPVIIFCHGYGASADHLTFFPTMCVCA
NLRPTWVFPHGIEQLPYQLGGGRAWFPLDTVLFEKLISSQEITPDTDRLY
QQLLDVDFEKPKQALEGLIHELERDRSEVIIGGFSQGAMMTTHLMLSSRL
PYRGALICSGAAVPNQSWEENASLCGKTPYIQSHGYDDPILPYFLGERLY
KVLTASLKGEMVSFHGGHEIPVVMMQKIQESIALWSQLT

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCTATTCTTTTTTTCGTCGAAAGCTTGCTGGGATAGAATTTATAGA
GTGTCCTGGAGATCCTGAAGCTCCTGTGATCATTTTTTGTCACGGGTATG
GCGCAAGTGCCGATCATCTTACTTTTTTCCCAACCATGTGCGTGTGCGCC
AATTTGCGTCCCACATGGGTCTTCCCTCATGGTATAGAACAGCTTCCCTA
CCAGTTGGGAGGGGGACGAGCTTGGTTTCCATTGGATACCGTTCTTTTTG
AAAAATTGATTTCTTCTCAGGAAATCACTCCAGATACGGATCGTTTATAT
CAGCAGCTATTGGATGTAGACTTTGAAAAGCCTAAACAGGCTTTAGAGGG
TCTTATTCACGAGTTGGAAAGAGATCGATCGGAAGTGATTATTGGAGGTT
TTAGTCAGGGAGCTATGATGACGACGCATCTGATGCTTTCTTCGCGGCTT
CCTTATCGAGGTGCTTTGATTTGCTCTGGAGCAGCCGTTCCGAATCAATC
TTGGGAAGAAAATGCGTCTTTATGTGGGAAAACTCCTTATATACAAAGTC
ATGGGTACGATGATCCTATTTTGCCCTATTTCTTAGGGGAGCGGTTATAT
AAGGTTTTAACAGCTTCTTTAAAAGGCGAGATGGTTTCTTTTCATGGAGG
ACATGAAATTCCTGTTGTTATGATGCAAAAGATACAGGAAAGCATCGCGC
TATGGAGTCAGTTGACA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy