Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR103 IGR109 IGR105 IGR106 IGR107 IGR108 IGR104 adk, - CT128 ydhO, - CT127 CT132 CT131 rs9, - CT126 rl13, - CT125 accB, - CT123 glnP, - CT129 glnQ, - CT130 accC, - CT124 adk, - CT128 ydhO, - CT127 CT132 CT131 rs9, - CT126 rl13, - CT125 accB, - CT123 glnP, - CT129 glnQ, - CT130 accC, - CT124 adk, - CT128 ydhO, - CT127 CT132 CT131 rs9, - CT126 rl13, - CT125 accB, - CT123 glnP, - CT129 glnQ, - CT130 accC, - CT124
* Calculated from Protein Sequence

Gene ID: CT129

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glnP  

Definition:
probable amino-acid ABC transporter permease protein

Gene Start:
144300

Gene Stop:
144941

Gene Length:
642

Molecular Weight*:
23555

pI*:
9.30

Net Charge*:
5.28

EC:
 

Functional Class:
transport and binding; amino acids, peptides and amines  

Pathway: pathway table
Membrane Transport; ATP-binding cassette (ABC) transport system

Comment:
A probable amino acid binding periplasmic protein. See CT130.

For a recent review of ABC transporters, please see Nikaido and Hall. 1998. Overview of bacterial ABC transporters. Methods Enzymol 292:3-20. Medline: 9711542. See also, Linton and Higgins, 1998 (Medline: 9593292), Saier et al., 1998 (Medline: 9506471), and Fath and Kolter, 1993 (Medline: 8302219).

For a complete listing of Chlamydia ABC transporters, alignments of transporters, nucleotide binding domain organization,and plasma membrane organization, please go to: http://www.stdgen.lanl.gov, choose Bacteria under the Analysis heading on the left-side navigation frame, then click on the ABC transporters analysis subsection.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to probable amino-acid ABC transporter permease proteins, e.g., 36% similarity to YECS_ECOLI, 32% similarity to YCKJ_BACSU.

CT129 is orthologously related to CPn0192: residues 1-211 are 70% similar to CPn0192. No similarities to T .pallidum or M. genitalium.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0765
COG name: Amino acid ABC transporter permease component
Functional Class:  E
The phylogenetic pattern of COG0765 is a-----vcEB-HUJ----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 97-165 are 49% similar to a permease protein domain as observed in YQIY_BACSU. Residues 13-96 are consistent with this observation.


Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
Residues 15 to 214 (E-value = 4e-17) place CT129 in the BPD_transp_1 family which is described as Binding-protein-dependent transport system inner membrane component (PF00528)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
17  
40
transmembrane  
52  
75
transmembrane  
79  
101
transmembrane  
187  
204

PDB Hit:
None.

Gene Protein Sequence:
MEHYLLTAKLLLRGCGYTLLITAISLVCGFVLGWGIGTVNSRYFPCRISK
FLGNFYVVAVRGTPLFIQILIVYFGLPSLIKVNLSPLVAGLIALTLNSAA
YLAENVRAGINALPVQQWEAAKVLGYTGPQIFLHILYPQVFKNILPSLTN
EFVSLIKESSILMVVGVPELTKVTKDIVARELNPMEMYLICAGLYLIMTS
AFSYFARLSEKESA

Gene Nucleotide Sequence:  Sequence Viewer
GTGGAACACTATTTGCTAACAGCAAAATTACTTCTTCGCGGGTGCGGATA
CACCCTATTGATTACAGCTATTTCTTTGGTGTGTGGGTTTGTACTGGGCT
GGGGTATAGGAACTGTGAATTCTCGGTACTTCCCTTGTCGTATATCTAAA
TTTTTAGGGAATTTTTATGTAGTGGCGGTTCGAGGAACACCGCTGTTCAT
TCAAATTTTGATTGTGTATTTCGGATTGCCTTCTTTGATCAAAGTTAATT
TATCCCCACTGGTGGCCGGACTGATCGCCCTAACCTTGAATTCTGCTGCT
TACTTAGCTGAAAATGTGCGTGCGGGGATCAATGCGCTACCTGTTCAACA
ATGGGAGGCAGCAAAAGTGTTGGGGTATACAGGACCACAGATCTTCTTGC
ATATATTGTATCCTCAAGTTTTTAAAAATATTCTTCCTTCTCTAACGAAT
GAGTTTGTTTCTTTAATCAAAGAGAGCAGCATTCTTATGGTAGTAGGAGT
TCCTGAATTAACAAAAGTCACTAAAGACATTGTAGCTCGGGAACTCAACC
CTATGGAGATGTATTTAATCTGTGCAGGGCTTTATTTGATAATGACCTCT
GCTTTTTCTTATTTTGCTAGATTATCAGAGAAGGAGTCTGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy